Sinorhizobium meliloti 1021

  1. SMa0617fixP3AAK64981.1FixP3 Diheme c-type cytochrome

fixP3 SMa0617
SMa0616
SMa0616
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
Rhizobase ORFeomeORFeome StringString database Multalin
Multalin
SMa0620
SMa0620
ID fixP3
AC AAK64981.1
LT SMa0617
OR AE006469 from 329568 to 330449 on strand +
DE FixP3 Diheme c-type cytochrome
IP Cytochrome c oxidase cbb3-type, subunit III
CL I.G.1 electron transport
EC
GO Biological Process: electron transport (GO:0006118)
Molecular Function: cytochrome-c oxidase activity (GO:0004129)
Molecular Function: iron ion binding (GO:0005506)
Molecular Function: heme binding (GO:0020037)
Molecular Function: electron carrier activity (GO:0009055)
PM
AN
SQ 293 aa
 
........10........20........30........40........50
| | | | |
MDVEEVDPISGRRTTGHEWNGIKELDTPVPRGVLLFLVVTHVFALLWWVL
LPTWPLGTTYTKGLLGIDERNVVEEKLAAAAAARAVWEKRIDTLSYEQIR
ADEQLMATVRSTGHQLFGDNCAVCHGIDGKGRSNYPDLTDDDWLWGGGPE
DIEQTLRVGINTRHPESRVAQMPSFGREQMLERNQVRDVAAYVYSLTNPG
YSTPENIGRIEAGREVFLTSCAACHGENARGSREVGAPNLTDAYWIYGGT
MQTIIESVHGGRQGHMPTWDERLTSAEIKILALYINSLGVEKP
rhime AAK65071.1 | fixP2

1

289

S=577 I=42 E=2.20594e-63

[lcl|fixP2] FixP2 Diheme c-type cytochrome
rhime AAK65320.1 | fixP1

4

289

S=554 I=43 E=1.51246e-60

[lcl|fixP1] FixP1 di-heme c-type cytochrome
pubmed

2

292

S=486 I=36 E=2.25607e-50

Membrane-anchored protein (Cbb3 oxidase subunit III)

Pubmed 8386371

 

prodomImg

pubmed

1

289

S=468 I=35 E=4.00438e-48

Cytcbb3 cytochrome c oxidase CytP subunit

Pubmed 9791120

 

prodomImg

pubmed

6

289

S=447 I=34 E=1.15815e-45

FixP protein

Pubmed 8282187

 

prodomImg

pubmed

4

289

S=439 I=36 E=1.07922e-44

FixP (FixP1 di-heme c-type cytochrome) EC=1.9.3.1 ; Oxidoreductase Plasmid

Pubmed 11902723

 

prodomImg

pubmed

2

289

S=438 I=35 E=1.54296e-44

ORFR

Pubmed 15060023

 

prodomImg

pubmed

14

289

S=434 I=35 E=4.87724e-44

Cbb3-type cytochrome c oxidase CcoP subunit

Pubmed 9711295

 

prodomImg

pubmed

1

289

S=427 I=33 E=3.37893e-43

FixPc

Pubmed 9204566

 

prodomImg

pubmed

13

289

S=394 I=32 E=3.1135e-39

CcoP

Pubmed 7891558

 

prodomImg

pubmed

13

289

S=392 I=33 E=5.584e-39

Di-heme cytochrome cp

Pubmed 9473054

 

prodomImg

pubmed

1

289

S=385 I=32 E=4.64586e-38

Di-heme cytochrome c

Pubmed 10223993

 

prodomImg

sp

208

285

S=108 I=34 E=9.65326e-05

Cytochrome c6 - Bryopsis maxima (Green alga)

Pubmed 3481367,

 

prodomImg

trembl

1

293

S=1279 I=84 E=1.40993e-145

Cytochrome c oxidase, cbb3-type, subunit III precursor - Sinorhizobium medicae (strain WSM419) (Ensifer medicae)

 

prodomImg

trembl

1

289

S=902 I=56 E=7.90228e-100

Putative membrane-anchored cbb3 cytochrome oxidase subunit - Rhizobium leguminosarum bv. viciae (strain 3841)

 

prodomImg

trembl

7

293

S=729 I=48 E=7.43367e-79

Cytochrome c oxidase, Cbb3-type, subunit III - Oligotropha carboxidovorans OM5

 

prodomImg

Iprscan IPR008168 [PR00605]

119

130

Cytochrome c, class IC

Iprscan IPR008168 [PR00605]

263

285

Cytochrome c, class IC

Iprscan IPR009056 [G3DSA:1.10.760.10]

107

196

Cytochrome c, monohaem

Iprscan IPR009056 [G3DSA:1.10.760.10]

206

288

Cytochrome c, monohaem

Iprscan IPR004678 [PIRSF000006]

1

292

Cytochrome c oxidase cbb3-type, subunit III

Iprscan IPR003088 [PF00034]

210

289

Cytochrome c, class I

Iprscan IPR004678 [TIGR00782]

4

292

Cytochrome c oxidase cbb3-type, subunit III

Iprscan IPR009056 [PS51007]

108

197

Cytochrome c, monohaem

Iprscan IPR009056 [PS51007]

208

289

Cytochrome c, monohaem

Iprscan [signalp]

1

44

-

Iprscan [tmhmm]

32

54

-

Iprscan IPR009056 [SSF46626]

208

288

Cytochrome c, monohaem

Iprscan IPR009056 [SSF46626]

29

201

Cytochrome c, monohaem

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 5gxZXSWM)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

20 hits
swiss-prot

Swiss-Prot ncbi-blastp

1 hits
trembl

TrEMBL ncbi-blastp

401 hits
trembl

Sinorhizobium meliloti proteome ncbi-blastp

3 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

13 hits