Ralstonia solanacearum sp.

  1. RSc2169prhMRSc2169LamB/YcsF family protein

prhM RSc2169
RSc2168
RSc2168
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Find Mutants

Find Clones
Remora
Multalin
RSc2170
RSc2170
ID prhM
AC NP_520290.1
LT RSc2169
SY RS01430
RX strain GMI1000
OR AL646052 from 2352050 to 2352793 on strand -
DE LamB/YcsF family protein
IP LamB/YcsF
CL VI.C Hypothetical/Global homology
EC
GO
PM
AN
SQ 247 aa
 
........10........20........30........40........50
| | | | |
MTAIDLNADLGEGCDNDEALLALVSSANIACGWHAGDVNTMRQTTAWALR
QGVSIGAHPSFPDRENFGRTEMHLPPDEVYAGVLFQIGGLSAIVRAQGGR
LAHVKPHGALYNQAARDRPLAMAIARAVRDFDASLAVFGLAGGELVLAAR
ELGLAAKEEVFADRGYNADGTLVKRGTPGALLENEEAALSQTLAMVREQR
VQSVDGVWVPIRAQTVCLHGDGAHALAFARRIRDRLGSEGIAVRAGA
Show or not Domain decomposition
 
ralso

NP_522497.1 lcl|RSp0936

4

240

S=426 I=40 E=3.66357e-45

hypothetical protein

pubmed

1

245

S=666 I=52 E=2.64141e-72

UPF0271 protein rni3

Pubmed 10722605

 

prodomImg

pubmed

1

245

S=636 I=49 E=1.3571e-68

UPF0271 protein HI1729

Pubmed 10675023

 

prodomImg

pubmed

1

245

S=610 I=50 E=1.83675e-65

UPF0271 protein ycsF

Pubmed 8969502

 

prodomImg

pubmed

3

245

S=610 I=53 E=1.86906e-65

UPF0271 protein BP0150

Pubmed 9583950

 

prodomImg

pubmed

6

124

S=267 I=44 E=7.54642e-24

Lactam utilization protein lamB

Pubmed 1729609

 

prodomImg

sp_Pdown

Q477G2|Y089_RALEJ

4

247

S=992 I=77 E=5.21806e-112

UPF0271 protein Reut_A0089 - Ralstonia eutropha (strain JMP134) (Alcaligenes eutrophus)

sp_Pdown

Q0KFE3|Y126_RALEH

4

246

S=986 I=77 E=3.37149e-111

UPF0271 protein H16_A0126 - Ralstonia eutropha (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) (Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337))

sp_Pdown

Q1LSC6|Y064_RALME

4

246

S=961 I=74 E=3.76667e-108

UPF0271 protein Rmet_0064 - Ralstonia metallidurans (strain CH34 / ATCC 43123 / DSM 2839)

sp_Pdown

Q13T51|Y4200_BURXL

4

245

S=875 I=70 E=7.90625e-98

UPF0271 protein Bxeno_A4200 - Burkholderia xenovorans (strain LB400)

sp_Pdown

A4JIL2|Y3124_BURVG

4

245

S=858 I=68 E=9.73019e-96

UPF0271 protein Bcep1808_3124 - Burkholderia vietnamiensis (strain G4 / LMG 22486) (Burkholderia cepacia (strain R1808))

trembl_Pdown

A7CME2|A7CME2_BURPI

1

247

S=1172 I=89 E=1.20211e-132

LamB/YcsF family protein - Ralstonia pickettii 12D

trembl_Pdown

B2U8X6|B2U8X6_BURPI

1

247

S=1161 I=89 E=2.41268e-131

LamB/YcsF family protein - Ralstonia pickettii 12J

trembl_Pdown

B2AG42|B2AG42_CUPTR

4

246

S=991 I=77 E=8.69833e-111

Putative lipoprotein, LamB/YcsF family protein - Cupriavidus taiwanensis (strain R1 / LMG 19424) (Ralstonia taiwanensis (strain LMG 19424))

Iprscan [PD011312]

68

117

-

Iprscan IPR005501 [PF03746]

3

239

LamB/YcsF

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one xyLE4vPn)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

N/A hits
swiss-prot

Swiss-Prot ncbi-blastp

N/A hits
trembl

TrEMBL ncbi-blastp

N/A hits
trembl

Ralstonia solanacearum str.GMI1000 proteome ncbi-blastp

N/A hits
hamap

HAMAP scan

N/A hits
Interpro Scan

IprScan

N/A hits