Ralstonia solanacearum sp.

3 hits

  1. RSc1721prhNRSc1721Transcriptional Regulator PrhN
  2. RSc1880prhORSc1880transcription regulator protein PrhO
  3. RSp0526RSp0526RSp0526TRANSCRIPTION REGULATOR, IscR family

prhN RSc1721
RSc1720
RSc1720
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Find Mutants

Find Clones
Remora
Multalin
RSc1722
RSc1722
ID prhN
AC NP_519842.1
LT RSc1721
SY RS02911
RX strain GMI1000
OR AL646052 from 1841340 to 1841906 on strand +
DE Transcriptional Regulator PrhN
IP Uncharacterised conserved protein UCP036158, transcription regulator, MarR-type HTH region
CL VI.A Not classified regulator
EC
GO
PM
AN
SQ 188 aa
 
........10........20........30........40........50
| | | | |
MSKSSSSSKVDLPEAAANEGGKSGAIVSSAHLVSARSPELSEFEFALNTA
YNAYHRWCVRCMAAAGVRDLTFLDVLVVHHVNHRGRAKRLADICFVLNVE
DTHLVTYSLKKLQALELVEGTRNGKEVTYTTTATGETACARYREIREQCL
TSNISPGGEENAEIGELARLMRVLTGLYEQAARSATSL
trembl_Pdown

B2UF63|B2UF63_BURPI

1

188

S=801 I=81 E=6.515e-88

Putative transcriptional regulator - Ralstonia pickettii 12J

trembl_Pdown

A7CLE2|A7CLE2_BURPI

1

188

S=796 I=81 E=2.24698e-87

Putative transcriptional regulator - Ralstonia pickettii 12D

trembl_Pdown

Q472C4|Q472C4_RALEJ

26

188

S=688 I=82 E=3.12289e-74

Putative uncharacterized protein - Ralstonia eutropha (strain JMP134) (Alcaligenes eutrophus)

Iprscan IPR014601 [PIRSF036158]

1

188

Uncharacterised conserved protein UCP036158, transcription regulator, MarR-type HTH region

Iprscan [SSF46785]

36

160

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one NsFIfAnr)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

N/A hits
swiss-prot

Swiss-Prot ncbi-blastp

N/A hits
trembl

TrEMBL ncbi-blastp

N/A hits
trembl

Ralstonia solanacearum str.GMI1000 proteome ncbi-blastp

N/A hits
hamap

HAMAP scan

N/A hits
Interpro Scan

IprScan

N/A hits
prhO RSc1880
RSc1879
RSc1879
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Find Mutants

Find Clones
Remora
Multalin
RSc1881
RSc1881
ID prhO
AC NP_520001.1
LT RSc1880
SY RS03440
RX strain GMI1000
OR AL646052 from 2063472 to 2064446 on strand +
DE transcription regulator protein PrhO
IP LysR, substrate-binding; Winged helix repressor DNA-binding
CL VI.A Not classified regulator
EC
GO DNA-dependent (GO:0006355)
Molecular Function: transcription factor activity (GO:0003700)
PM
AN
SQ 324 aa
 
........10........20........30........40........50
| | | | |
MELRQLEAFAAVMSTGSVTAAGKLLGRSQPAISRLIQDLEAEIGYALFTR
SGPRVSPTEQGFLLYEDVEHTLISLRQIRTRAEEIARGEARPLRLAATSA
LAAGLLPAALADDAELGRHIQIRSASPEQVVHAVLTGAADLGVSSLPLEH
RGVTVHWIGEAACVAAVQAGDPLAAGDRVALADCGGRRIITMHNPYRLRR
RLDFALAQAGVTPAELIETNASFNALTTVRAGLGVALLEPVTAYGVPIEG
VTVRPIDVSIPFFFGVITPEARRPSPAVTALIDALSRAAQRLLPDCKLHD
PARHASMLQVLYGEPLNETEGASA
Show or not Domain decomposition
 
ralso

NP_520618.1 lcl|RSc2497

1

292

S=183 I=23 E=1.30461e-15

transcription regulator protein

ralso

NP_519469.1 lcl|cysB1-RSc1348

1

238

S=165 I=27 E=1.99661e-13

transcriptional regulator CysB-like protein

ralso

NP_520548.1 lcl|cysB2-RSc2427

1

238

S=131 I=25 E=2.99783e-09

transcriptional regulator CysB-like protein

ralso

NP_522503.1 lcl|nac-RSp0942

1

88

S=122 I=33 E=2.96933e-08

nitrogen assimilation transcriptional regulator

ralso

NP_521451.1 lcl|RSc3332

2

85

S=122 I=35 E=3.1562e-08

transcription regulator protein

ralso

NP_520619.1 lcl|RSc2498

1

78

S=111 I=35 E=6.11752e-07

transcription regulator protein

ralso

NP_522384.1 lcl|RSp0823

140

285

S=110 I=30 E=8.52046e-07

transcription regulator protein

ralso

NP_521399.1 lcl|RSc3280

2

75

S=110 I=39 E=9.88174e-07

transcription regulator protein

ralso

NP_518925.1 lcl|RSc0804

1

67

S=110 I=41 E=1.04124e-06

transcription regulator protein

ralso

NP_522558.1 lcl|RSp0997

5

88

S=109 I=36 E=1.27245e-06

transcription regulator protein

pubmed

1

274

S=283 I=30 E=1.20671e-25

Regulatory protein nocR ; Activator DNA-binding Plasmid Transcription regulation

Pubmed 1799698

 

prodomImg

pubmed

1

274

S=283 I=30 E=1.28266e-25

Tiorf6 protein ; DNA-binding Plasmid Transcription regulation

Pubmed 10721727,9524202

 

prodomImg

pubmed

1

274

S=278 I=29 E=4.58078e-25

Regulatory protein nocR ; Activator DNA-binding Plasmid Transcription regulation

Pubmed 8232213

 

prodomImg

pubmed

4

285

S=273 I=30 E=1.80062e-24

Positive regulator for lys ; DNA-binding Transcription regulation

Pubmed 12754231

 

prodomImg

pubmed

1

232

S=239 I=32 E=2.72723e-20

OccR ; DNA-binding Plasmid Transcription regulation

Pubmed 16547030

 

prodomImg

pubmed

1

232

S=239 I=32 E=2.72723e-20

Octopine catabolism/uptake operon regulatory protein occR ; Activator DNA-binding Plasmid Transcription regulation

Pubmed 1799699

 

prodomImg

pubmed

1

232

S=239 I=32 E=2.72723e-20

Octopine catabolism/uptake operon regulatory protein occR ; Activator DNA-binding Plasmid Transcription regulation

Pubmed 1799698

 

prodomImg

pubmed

1

283

S=169 I=24 E=7.84828e-12

Uncharacterized HTH-type transcriptional regulator ywbI ; DNA-binding regulation

Pubmed 7934828

 

prodomImg

pubmed

1

257

S=167 I=25 E=1.15181e-11

HTH-type transcriptional regulator alsR ; Acetoin biosynthesis DNA-binding regulation

Pubmed 7685336,9353933

 

prodomImg

pubmed

1

238

S=163 I=28 E=3.45526e-11

Putative reguratory protein ; DNA-binding Transcription regulation

Pubmed 15451113

 

prodomImg

sp_Pdown

Q00678|NOCR_AGRT5

1

274

S=283 I=30 E=7.60262e-26

Regulatory protein nocR - Agrobacterium tumefaciens (strain C58 / ATCC 33970)

sp_Pdown

P35112|NOCR_AGRT7

1

274

S=278 I=29 E=2.88601e-25

Regulatory protein nocR - Agrobacterium tumefaciens (strain T37)

sp_Pdown

P72294|OCCR_RHIME

1

260

S=264 I=31 E=1.62056e-23

Octopine catabolism/uptake operon regulatory protein occR - Rhizobium meliloti (Sinorhizobium meliloti)

sp_Pdown

P0A4T3|OCCR_AGRTU

1

232

S=239 I=32 E=1.71823e-20

Octopine catabolism/uptake operon regulatory protein occR - Agrobacterium tumefaciens

sp_Pdown

P0A4T4|OCCR_AGRT4

1

232

S=239 I=32 E=1.71823e-20

Octopine catabolism/uptake operon regulatory protein occR - Agrobacterium tumefaciens (strain Ach5)

trembl_Pdown

A7CIS7|A7CIS7_BURPI

1

324

S=1367 I=83 E=4.06998e-156

Transcriptional regulator, LysR family precursor - Ralstonia pickettii 12D

trembl_Pdown

B2U6T3|B2U6T3_BURPI

1

324

S=1346 I=82 E=1.32994e-153

Transcriptional regulator, LysR family precursor - Ralstonia pickettii 12J

trembl_Pdown

Q471W3|Q471W3_RALEJ

1

320

S=930 I=59 E=3.05034e-103

Transcriptional regulator, LysR family - Ralstonia eutropha (strain JMP134) (Alcaligenes eutrophus)

Iprscan IPR000847 [PR00039]

18

29

Bacterial regulatory protein, LysR

Iprscan IPR000847 [PR00039]

29

39

Bacterial regulatory protein, LysR

Iprscan IPR000847 [PR00039]

39

50

Bacterial regulatory protein, LysR

Iprscan IPR011991 [G3DSA:1.10.10.10]

1

87

Winged helix repressor DNA-binding

Iprscan [G3DSA:3.40.190.10]

164

262

-

Iprscan IPR000847 [PF00126]

3

62

Bacterial regulatory protein, LysR

Iprscan IPR005119 [PF03466]

86

290

LysR, substrate-binding

Iprscan IPR000847 [PS50931]

1

58

Bacterial regulatory protein, LysR

Iprscan [SSF46785]

1

105

-

Iprscan [SSF53850]

86

318

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one dOhXNgmx)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

N/A hits
swiss-prot

Swiss-Prot ncbi-blastp

N/A hits
trembl

TrEMBL ncbi-blastp

N/A hits
trembl

Ralstonia solanacearum str.GMI1000 proteome ncbi-blastp

N/A hits
hamap

HAMAP scan

N/A hits
Interpro Scan

IprScan

N/A hits
RSp0526 RSp0526
RSp0525
RSp0525
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Find Mutants

Find Clones
Remora
Multalin
RSp0527
RSp0527
ID RSp0526
AC NP_522087.1
LT RSp0526
SY RS00405
RX strain GMI1000
OR AL646053 from 656937 to 657368 on strand -
DE TRANSCRIPTION REGULATOR, IscR family
IP Transcriptional regulator, Rrf2
CL VI.A Not classified regulator
EC
GO
PM
AN
SQ 143 aa
 
........10........20........30........40........50
| | | | |
MSTSSRFAVAVHILTLLASAGEPVPSSLIAGSVGTNPALIRRLVALLAEA
GFVTSQMGASGGSTLARPADRITLLDVFRAVESPVLIALPHSQPNPACEV
GREITGVLERVTARAQSAMEAELAAQTIAGMLTEVGRAQRRRA
Show or not Domain decomposition
 
ralso

NP_519139.1 lcl|RSc1018

1

85

S=91 I=32 E=5.93224e-05

hypothetical protein

pubmed

4

135

S=273 I=42 E=4.07636e-25

Putative uncharacterized protein ywnA (YwnA protein)

Pubmed 9150240

 

prodomImg

pubmed

1

135

S=228 I=42 E=1.17601e-19

Putative uncharacterized protein ; Plasmid

Pubmed 12791134,10954087

 

prodomImg

pubmed

6

139

S=145 I=34 E=1.3884e-09

Transcriptional regulator ; Plasmid

Pubmed 15328093,18440636

 

prodomImg

pubmed

26

124

S=142 I=34 E=3.62269e-09

Putative transcriptional regulator

Pubmed 18245259,17449683

 

prodomImg

pubmed

26

139

S=123 I=29 E=5.99685e-07

Putative transcriptional regulator

Pubmed 17449683

 

prodomImg

pubmed

1

134

S=122 I=27 E=8.95576e-07

Protein rrf2 ; DNA-binding

Pubmed 8335628

 

prodomImg

pubmed

1

135

S=114 I=28 E=7.58222e-06

Similar to B.subtilis ywgB gene(27%-identity) (BH0656 protein) ; 2Fe-2S DNA-binding Iron Iron-sulfur Metal-binding

Pubmed 10086842

 

prodomImg

pubmed

1

82

S=107 I=34 E=5.25292e-05

Putative uncharacterized protein ; 2Fe-2S DNA-binding Iron Iron-sulfur Metal-binding

Pubmed 15262926

 

prodomImg

sp_Pdown

P33395|RRF2_DESVH

1

134

S=122 I=27 E=5.88255e-07

Protein rrf2 - Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303)

sp_Pdown

P67160|Y1318_MYCBO

1

134

S=105 I=28 E=6.69326e-05

Putative HTH-type transcriptional regulator Mb1318 - Mycobacterium bovis

sp_Pdown

P67159|Y1287_MYCTU

1

134

S=105 I=28 E=6.69326e-05

Putative HTH-type transcriptional regulator Rv1287/MT1325 - Mycobacterium tuberculosis

sp_Pdown

P71047|YWGB_BACSU

23

82

S=104 I=39 E=8.25114e-05

Putative HTH-type transcriptional regulator ywgB - Bacillus subtilis

trembl_Pdown

Q46ZJ6|Q46ZJ6_RALEJ

1

142

S=512 I=75 E=3.19656e-53

Transcriptional regulator, BadM/Rrf2 family - Ralstonia eutropha (strain JMP134) (Alcaligenes eutrophus)

trembl_Pdown

Q1LLK4|Q1LLK4_RALME

1

142

S=472 I=69 E=2.38734e-48

Transcriptional regulator, BadM/Rrf2 family precursor - Ralstonia metallidurans (strain CH34 / ATCC 43123 / DSM 2839)

trembl_Pdown

Q0K975|Q0K975_RALEH

9

142

S=445 I=69 E=3.71483e-45

Putative Transcriptional regulator - Ralstonia eutropha (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) (Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337))

Iprscan IPR000944 [PF02082]

1

123

Transcriptional regulator, Rrf2

Iprscan IPR000944 [PS51197]

1

133

Transcriptional regulator, Rrf2

Iprscan [signalp]

1

20

-

Iprscan [SSF46785]

5

133

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one aqOyiOXN)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

N/A hits
swiss-prot

Swiss-Prot ncbi-blastp

N/A hits
trembl

TrEMBL ncbi-blastp

N/A hits
trembl

Ralstonia solanacearum str.GMI1000 proteome ncbi-blastp

N/A hits
hamap

HAMAP scan

N/A hits
Interpro Scan

IprScan

N/A hits