Ralstonia solanacearum sp.

  1. RSp0252feoARSp0252Ferrous iron transporter, FeoA subunit

feoA RSp0252
RSp0251
RSp0251
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Find Mutants

Find Clones
Remora
Multalin
RSp0253
RSp0253
ID feoA
AC NP_521813.1
LT RSp0252
SY RS03714
RX strain GMI1000
OR AL646053 from 324675 to 324986 on strand -
DE Ferrous iron transporter, FeoA subunit
IP Ferrous iron transporter, FeoA subunit
CL IV.D.5 incorporation metal ions
EC
GO Molecular Function: iron ion binding (GO:0005506)
PM
AN
SQ 103 aa
 
........10........20........30........40........50
| | | | |
MRLSELSRRATAVVDHVEDREPADPISQRLRELGFVMGEQVCVVAVGPFG
GDPLVVQVGFTRFALRKQEAARVRVRAEAATQQAQPVVMASETAPPAQVR
KAA
Show or not Domain decomposition
 
trembl_Pdown

B2UHK3|B2UHK3_BURPI

1

103

S=327 I=69 E=4.21957e-31

FeoA family protein - Ralstonia pickettii 12J

trembl_Pdown

A7C8I3|A7C8I3_BURPI

1

103

S=327 I=69 E=4.21957e-31

FeoA family protein - Ralstonia pickettii 12D

trembl_Pdown

B2AHN0|B2AHN0_CUPTR

1

65

S=229 I=69 E=3.50902e-19

Ferrous iron transport protein A - Cupriavidus taiwanensis (strain R1 / LMG 19424) (Ralstonia taiwanensis (strain LMG 19424))

Iprscan IPR007167 [PF04023]

1

77

Ferrous iron transporter, FeoA subunit

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one EpN1uaOI)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

N/A hits
swiss-prot

Swiss-Prot ncbi-blastp

N/A hits
trembl

TrEMBL ncbi-blastp

N/A hits
trembl

Ralstonia solanacearum str.GMI1000 proteome ncbi-blastp

N/A hits
hamap

HAMAP scan

N/A hits
Interpro Scan

IprScan

N/A hits