Ralstonia solanacearum sp.

2 hits

  1. RSc0869RSc0869putative cytosine-specific methyltransferase protein
  2. RSc1319RSc1319Bifunctional UDP-4-keto-pentose/UDP-xylose synthase

RSc0869
RSc0868
RSc0868
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Find Mutants

Find Clones
Remora
Multalin
RSc0870
RSc0870
ID
AC NP_518990.1
LT RSc0869
SY RS04946
RX strain GMI1000
OR AL646052 from 903269 to 904393 on strand +
DE putative cytosine-specific methyltransferase protein
IP C-5 cytosine-specific DNA methylase
CL II.B.8 DNA - replication, repair, restr./modif.
EC
GO Biological Process: DNA methylation (GO:0006306)
Molecular Function: DNA binding (GO:0003677)
PM
AN
SQ 375 aa
 
........10........20........30........40........50
| | | | |
MGAYYNEIDPYAAAWLRNLIAAGHIAPGDVDERDIQDVRPEDLRGYKQHH
FFAGVGVWSLALRRAGWPDDRLVWTGSCPCQPFSQAGKGLAFADERHLWP
AWYHLISECRPAVVLGEQVASNNADTWIDLVQDDMEAVGHAFGAVPFPAA
GVGAPHIRDRLYWVAYADGSRSRRYSRAVRRAKAEINREGSEDGSNPDGF
ELGRTNGRLAHSLPAGRTEGRPFAGNRSPSGLCVVGGLADTNGGYTGAER
QQRCGQQRQQPEDGGIGLGLGHAEREGLALGQRLARVPGAASGTDPRQAV
ERAGIHVASGPGPTNGLWRDADWLLCRDGRWRPVEPGAFPLAHGAPARVG
RLRAYGNAICASAAQAFIESVMAWL
Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one VmjFqB01)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

N/A hits
swiss-prot

Swiss-Prot ncbi-blastp

N/A hits
trembl

TrEMBL ncbi-blastp

N/A hits
trembl

Ralstonia solanacearum str.GMI1000 proteome ncbi-blastp

N/A hits
hamap

HAMAP scan

N/A hits
Interpro Scan

IprScan

N/A hits
RSc1319
RSc1318
RSc1318
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Find Mutants

Find Clones
Remora
Multalin
RSc1320
RSc1320
ID
AC NP_519440.1
LT RSc1319
SY RS02842
RX strain GMI1000
OR AL646052 from 1404147 to 1405202 on strand -
DE Bifunctional UDP-4-keto-pentose/UDP-xylose synthase
IP NAD-dependent epimerase/dehydratase;
CL II.B.2 lipopolysaccharides
EC
GO Biological Process: metabolic process (GO:0008152)
Biological Process: cellular metabolic process (GO:0044237)
Molecular Function: coenzyme binding (GO:0050662)
Molecular Function: binding (GO:0005488)
Molecular Function: catalytic activity (GO:0003824)
PM
AN
SQ 351 aa
 
........10........20........30........40........50
| | | | |
MKKVLILGVNGFIGHHLSKRILESTDPEISQWEVYGMDMQTERLGDLVNH
PRMHFFEGDITINKEWVEYHVRKCDVILPLVAIATPSTYVKAPLRVFELD
FEANLPIVRSAAKYGKHLVFPSTSEVYGMCGDDEFDPEASPLVYGPINKP
RWIYACSKQLMDRVIWGYGMEGLNFTLFRPFNWIGPGLDSIHTPKEGSSR
VVTQFLGHIVRGENIQLVDGGQQKRAFTYVDDGIDALVRIIANKDGVASG
KIYNIGNPSNNYSVRELAEMMLKKAGTIAEYKENAQKVKLVETTSGAYYG
KGYQDVQNRVPKIANTMEELGWKPTTTMEDTLANIFEAYREHAAEARSLV
D
Show or not Domain decomposition
 
pubmed

3

343

S=1001 I=55 E=1.14683e-112

Bifunctional polymyxin resistance protein arnA EC=2.1.2.n1 EC=1.1.1.n1 ; Antibiotic Lipid biosynthesis Lipopolysaccharide Methyltransferase Mult

Pubmed 15583148

 

prodomImg

pubmed

3

339

S=982 I=55 E=2.57584e-110

Bifunctional polymyxin resistance protein arnA EC=2.1.2.n1 EC=1.1.1.n1 ; Antibiotic Lipid biosynthesis Lipopolysaccharide Methyltransferase Multi

Pubmed 9570402

 

prodomImg

pubmed

3

339

S=970 I=53 E=7.45608e-109

Bifunctional polymyxin resistance protein arnA EC=2.1.2.n1 EC=1.1.1.n1 ; Antibiotic Lipid biosynthesis Lipopolysaccharide Methyltransferase Multi

Pubmed 11706007

 

prodomImg

pubmed

3

346

S=556 I=36 E=1.0495e-58

UDP-D-apiose/UDP-D-xylose synthase

Pubmed 16549428

 

prodomImg

pubmed

4

346

S=552 I=36 E=3.17591e-58

Putative dTDP-glucose 4-6-dehydratase (Putative uncharacterized protein) (UDP-D-apiose/UDP-D-xylose synthase) (At2g27860/F15K20.4)

Pubmed 12969423

 

prodomImg

pubmed

162

346

S=336 I=38 E=4.25357e-32

Nucleoside-diphopshate-sugar dehydratase

Pubmed 17041024

 

prodomImg

pubmed

1

342

S=294 I=29 E=5.50219e-27

Glucuronic acid decarboxylase

Pubmed 14528002,17918933

 

prodomImg

pubmed

3

342

S=293 I=28 E=6.84223e-27

Putative UDP-glucose 4-epimerase

Pubmed 16873021

 

prodomImg

pubmed

3

340

S=283 I=29 E=1.26963e-25

DTDP-glucose 4-6-dehydratase (UDP-glucuronic acid decarboxylase)

Pubmed 10048488

 

prodomImg

pubmed

1

341

S=273 I=27 E=1.79794e-24

dTDP-glucose 4,6-dehydratase EC=4.2.1.46 ; Lyase

Pubmed 18043661

 

prodomImg

sp_Pdown

A8GDR7|ARNA_SERP5

3

339

S=1016 I=54 E=1.13791e-114

Bifunctional polymyxin resistance protein arnA [Includes: UDP-4-amino-4-deoxy-L-arabinose formyltransferase - Serratia proteamaculans (strain 568)

sp_Pdown

Q7N3Q7|ARNA_PHOLL

2

345

S=1008 I=54 E=1.06036e-113

Bifunctional polymyxin resistance protein arnA [Includes: UDP-4-amino-4-deoxy-L-arabinose formyltransferase - Photorhabdus luminescens subsp. laumondii

sp_Pdown

A0KGY6|ARNA_AERHH

1

343

S=1007 I=55 E=1.36541e-113

Bifunctional polymyxin resistance protein arnA [Includes: UDP-4-amino-4-deoxy-L-arabinose formyltransferase - Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / NCIB 9240)

sp_Pdown

A1JPN5|ARNA_YERE8

3

339

S=1003 I=55 E=5.04939e-113

Bifunctional polymyxin resistance protein arnA [Includes: UDP-4-amino-4-deoxy-L-arabinose formyltransferase - Yersinia enterocolitica serotype O:8 / biotype 1B (strain 8081)

sp_Pdown

A4TIM4|ARNA_YERPP

3

343

S=1002 I=55 E=5.80528e-113

Bifunctional polymyxin resistance protein arnA [Includes: UDP-4-amino-4-deoxy-L-arabinose formyltransferase - Yersinia pestis (strain Pestoides F)

trembl_Pdown

B2UAS2|B2UAS2_BURPI

1

351

S=1719 I=91 E=0

NAD-dependent epimerase/dehydratase - Ralstonia pickettii 12J

trembl_Pdown

A7CD54|A7CD54_BURPI

1

351

S=1719 I=91 E=0

NAD-dependent epimerase/dehydratase - Ralstonia pickettii 12D

trembl_Pdown

B1JTE2|B1JTE2_BURCC

2

351

S=1578 I=83 E=0

NAD-dependent epimerase/dehydratase - Burkholderia cenocepacia (strain MC0-3)

Iprscan IPR016040 [G3DSA:3.40.50.720]

2

285

NAD(P)-binding

Iprscan [PTHR10366]

6

347

-

Iprscan [PTHR10366:SF35]

301

347

-

Iprscan [PTHR10366:SF35]

6

285

-

Iprscan [PTHR10366:SF35]

6

347

-

Iprscan IPR001509 [PF01370]

4

256

NAD-dependent epimerase/dehydratase

Iprscan IPR016040 [SSF51735]

1

348

NAD(P)-binding

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one j1HAX55Z)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

N/A hits
swiss-prot

Swiss-Prot ncbi-blastp

N/A hits
trembl

TrEMBL ncbi-blastp

N/A hits
trembl

Ralstonia solanacearum str.GMI1000 proteome ncbi-blastp

N/A hits
hamap

HAMAP scan

N/A hits
Interpro Scan

IprScan

N/A hits