Ralstonia solanacearum sp.

2 hits

  1. RSc2128RSc2128Xylulokinase family protein
  2. RSc2129RSc2129Mannitol-1-phosphate/altronate dehydrogenase family protein

RSc2128
RSc2127
RSc2127
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Find Mutants

Find Clones
Remora
Multalin
RSc2129
RSc2129
ID
AC NP_520249.1
LT RSc2128
SY RS01476
RX strain GMI1000
OR AL646052 from 2307583 to 2309058 on strand -
DE Xylulokinase family protein
IP Carbohydrate kinase, FGGY
CL I.F Central intermediary metabolism
EC
GO Biological Process: carbohydrate metabolic process (GO:0005975)
Biological Process: xylulose metabolic process (GO:0005997)
Molecular Function: xylulokinase activity (GO:0004856)
PM
AN
SQ 491 aa
 
........10........20........30........40........50
| | | | |
MYLGIDLGTSEVKVLLLAPDGTVVGTAGAPFTVSRPHPRWAEQHPEDWWQ
GTLAALGMLRARCPDAFARVRGIGLSGQMHGAVLLDQADRVLRPAILWND
MRSDDECALLTERAPDLHAIAGNLAMPGFTAPKLLWVARHEPDVFAATTC
VLLPKDYLRFRLTGAKVSDPSDAAGTLWLDVARRDWSDALLAACDLSRDQ
MPRLVEGNAPSGTLRADLARELGLDPRVVVAGGGGDNAASALGIGATHAG
DGFVSLGTSGVLSIVSDRFTPNPALATHAFCHAIPERWQLMTVVLSAASC
LRWICTLTGTDEPTLLAEVERLDPGACAQAPLFLPYLSGERTPHNDPYAQ
GVFFGMTHATERAHLGYAVLEGVTLGFADGFDALRGIETDALSLIGGGAR
SQYWAQMIADALNVRTRQHGGGETGAALGAARLGWLAVGGDPDTVLAKPP
VCAEYAPNAARHAALCERLVAFRELYRHVQPLYEPSRPRLA
Show or not Domain decomposition
 
ralso

NP_521173.1 lcl|glpK-RSc3052

3

414

S=177 I=24 E=1.20199e-14

ATP:glycerol 3-phosphotransferase protein

pubmed

1

476

S=1277 I=53 E=6.61039e-146

D-xylulose-kinase ; Transferase

Pubmed 9324246,9639934

 

prodomImg

pubmed

1

478

S=1261 I=50 E=5.49522e-144

Xylulose kinase ; Transferase

Pubmed 16151815

 

prodomImg

pubmed

1

482

S=1123 I=49 E=3.02081e-127

Xylulose kinase EC=2.7.1.17 ; Carbohydrate metabolism Transferase Xylose

Pubmed 6320721,8041620

 

prodomImg

pubmed

1

410

S=1059 I=54 E=1.87392e-119

Xylulose kinase EC=2.7.1.17 ; Carbohydrate metabolism Transferase Xylose

Pubmed 1324398

 

prodomImg

pubmed

2

416

S=852 I=40 E=1.98501e-94

Xylulose kinase ; Transferase

Pubmed 1368665,9495747

 

prodomImg

pubmed

3

415

S=689 I=38 E=1.31861e-74

Xylulose kinase EC=2.7.1.17 ; Carbohydrate metabolism Transferase Xylose

Pubmed 2994009

 

prodomImg

pubmed

3

415

S=671 I=38 E=1.62281e-72

Xylulose kinase EC=2.7.1.17 ; Carbohydrate metabolism Transferase Xylose

Pubmed 1660563

 

prodomImg

pubmed

3

413

S=671 I=35 E=1.86574e-72

Xylulokinase ; Transferase

Pubmed 10966417

 

prodomImg

pubmed

3

412

S=663 I=33 E=1.59342e-71

EF0083 (D-xylulose kinase) ; Transferase

Pubmed 12066186

 

prodomImg

pubmed

3

413

S=660 I=35 E=3.71212e-71

Xylulokinase ; Transferase

Pubmed 10966417

 

prodomImg

sp_Pdown

P09099|XYLB_ECOLI

1

482

S=1123 I=49 E=1.91457e-127

Xylulose kinase - Escherichia coli (strain K12)

sp_Pdown

P29444|XYLB_KLEPN

1

410

S=1059 I=54 E=1.18768e-119

Xylulose kinase - Klebsiella pneumoniae

sp_Pdown

P39211|XYLB_BACSU

3

415

S=689 I=38 E=8.35725e-75

Xylulose kinase - Bacillus subtilis

sp_Pdown

P21939|XYLB_LACPE

3

415

S=671 I=38 E=1.02852e-72

Xylulose kinase - Lactobacillus pentosus

sp_Pdown

Q9CFG8|XYLB_LACLA

3

413

S=664 I=35 E=9.17544e-72

Xylulose kinase - Lactococcus lactis subsp. lactis (Streptococcus lactis)

trembl_Pdown

A9AGG4|A9AGG4_BURM1

1

491

S=2017 I=80 E=0

Xylulokinase - Burkholderia multivorans (strain ATCC 17616 / 249)

trembl_Pdown

A2W7V8|A2W7V8_9BURK

1

491

S=1997 I=79 E=0

Sugar - Burkholderia dolosa AUO158

trembl_Pdown

Q39DF5|Q39DF5_BURS3

1

491

S=1979 I=80 E=0

Xylulokinase - Burkholderia sp. (strain 383) (Burkholderia cepacia (strain ATCC 17760 / NCIB 9086 / R18194))

Iprscan IPR000577 [PTHR10196]

49

484

Carbohydrate kinase, FGGY

Iprscan [PTHR10196:SF10]

49

484

-

Iprscan IPR000577 [PF00370]

1

243

Carbohydrate kinase, FGGY

Iprscan IPR000577 [PF02782]

246

439

Carbohydrate kinase, FGGY

Iprscan IPR006000 [TIGR01312]

3

477

Xylulokinase

Iprscan IPR000577 [PS00445]

351

371

Carbohydrate kinase, FGGY

Iprscan IPR000577 [PS00933]

128

140

Carbohydrate kinase, FGGY

Iprscan [SSF53067]

1

244

-

Iprscan [SSF53067]

245

484

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 35o1vrjV)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

N/A hits
swiss-prot

Swiss-Prot ncbi-blastp

N/A hits
trembl

TrEMBL ncbi-blastp

N/A hits
trembl

Ralstonia solanacearum str.GMI1000 proteome ncbi-blastp

N/A hits
hamap

HAMAP scan

N/A hits
Interpro Scan

IprScan

N/A hits
RSc2129
RSc2128
RSc2128
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Find Mutants

Find Clones
Remora
Multalin

ID
AC NP_520250.1
LT RSc2129
SY RS01475
RX strain GMI1000
OR AL646052 from 2309151 to 2310548 on strand -
DE Mannitol-1-phosphate/altronate dehydrogenase family protein
IP Mannitol dehydrogenase, core; 6-phosphogluconate dehydrogenase, C-terminal-like; Mannitol dehydrogenase, C-terminal;
CL I.F Central intermediary metabolism
EC
    GO Biological Process: metabolic process (GO:0008152)
    Molecular Function: coenzyme binding (GO:0050662)
    Molecular Function: catalytic activity (GO:0003824)
    Molecular Function: oxidoreductase activity (GO:0016491)
    Molecular Function: binding (GO:0005488)
    PM
    AN
    SQ 465 aa
     
    ........10........20........30........40........50
    | | | | |
    MTRSSLARAPVLLHIGAGSFHRAHQAWYLHRVNAAVPPGERWTLTVGNIR
    DDMHATLAALAAQQGAYTLETVTPQGERAYETIRSIARVLPWSADLAALI
    NTGADPACRIVSFTVTEGGYYLDEHDRLDVTHPDLAADLRGARSTLYGAL
    AALLAERRQRGAGPLTLQSCDNLRSNGARFRAGMRAFLALRGDAALLAWF
    DANVSCPSAMVDRITPRPTDDVRTRVHAATGVDDRCPVMGESFIQWVIED
    NFIAGRPAWEIAGAEIVADVHPYEEAKIRILNATHSCIAWAGTLAGLTYI
    HEGMRDAAIYRFAYDYVTDDVIPCLTPSPLDLERYRDVVLERFGNPYVLD
    TNQRVAADGFSKIPGFIAPTLAECFARGADPVATAVLPALFLGFLEGWAR
    GTLPYVYQDGVMDGAAARSIVEAPDSVAAFCSDRQLWGSLAGRDALVQAV
    RAGRARVEAWRAARR
    Show or not Domain decomposition
     
    pubmed

    13

    442

    S=1269 I=56 E=5.45818e-145

    D-arabinitol 4-dehydrogenase EC=1.1.1.11 ; NAD Oxidoreductase

    Pubmed 9639934

     

    prodomImg

    pubmed

    13

    444

    S=1247 I=54 E=2.93169e-142

    Arabitol dehydrogenase (D-arabitol dehydrogenase) ; NAD Oxidoreductase

    Pubmed 16151815

     

    prodomImg

    pubmed

    14

    409

    S=586 I=36 E=3.32206e-62

    Mannitol dehydrogenase EC=1.1.1.67 ; NAD Oxidoreductase

    Pubmed 9116029,9461423

     

    prodomImg

    pubmed

    1

    397

    S=574 I=37 E=1.12501e-60

    Mannitol 2-dehydrogenase EC=1.1.1.67 ; NAD Oxidoreductase

    Pubmed 8254318

     

    prodomImg

    pubmed

    10

    397

    S=552 I=37 E=4.77518e-58

    Mannitol 2-dehydrogenase EC=1.1.1.67 ; NAD Oxidoreductase

    Pubmed 9256491

     

    prodomImg

    pubmed

    10

    397

    S=545 I=34 E=3.33719e-57

    L-sorbose reductase ; NAD Oxidoreductase

    Pubmed 11790761

     

    prodomImg

    pubmed

    10

    397

    S=535 I=34 E=4.89355e-56

    Sorbitol dehydrogenase ; NAD Oxidoreductase

    Pubmed 16232778

     

    prodomImg

    pubmed

    193

    397

    S=398 I=41 E=1.96539e-39

    Putative uncharacterized protein ; NAD

    Pubmed 11555292

     

    prodomImg

    pubmed

    83

    373

    S=261 I=28 E=8.03241e-23

    Altronate oxidoreductase EC=1.1.1.58 ; NAD

    Pubmed 9579062

     

    prodomImg

    pubmed

    165

    269

    S=230 I=48 E=4.31076e-19

    Mannitol dehydrogenase ; Oxidoreductase

    Pubmed 15607633

     

    prodomImg

    sp_Pdown

    P58709|DALD_YERPE

    11

    444

    S=1299 I=58 E=8.52492e-149

    D-arabinitol 4-dehydrogenase - Yersinia pestis

    sp_Pdown

    O52720|DALD_KLEPN

    13

    442

    S=1269 I=56 E=3.46122e-145

    D-arabinitol 4-dehydrogenase - Klebsiella pneumoniae

    sp_Pdown

    P39941|YEI0_YEAST

    12

    377

    S=599 I=36 E=6.38558e-64

    Uncharacterized oxidoreductase YEL070W/YNR073C - Saccharomyces cerevisiae (Baker's yeast)

    sp_Pdown

    P33216|MTLK_RHOSH

    1

    397

    S=574 I=37 E=7.13406e-61

    Mannitol 2-dehydrogenase - Rhodobacter sphaeroides (Rhodopseudomonas sphaeroides)

    sp_Pdown

    P80354|POR_GLUOX

    10

    430

    S=527 I=33 E=3.10058e-55

    Polyol:NADP oxidoreductase - Gluconobacter oxydans (Gluconobacter suboxydans)

    trembl_Pdown

    B1FPQ3|B1FPQ3_9BURK

    1

    442

    S=1819 I=79 E=0

    Mannitol dehydrogenase domain - Burkholderia ambifaria IOP40-10

    trembl_Pdown

    B1YVS1|B1YVS1_BURA4

    1

    442

    S=1807 I=79 E=0

    Mannitol dehydrogenase domain - Burkholderia ambifaria (strain MC40-6)

    trembl_Pdown

    Q0BCD4|Q0BCD4_BURCM

    1

    442

    S=1800 I=79 E=0

    Mannitol dehydrogenase, C-terminal domain - Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) (Burkholderia cepacia (strain AMMD))

    Iprscan IPR000669 [PR00084]

    12

    22

    Mannitol dehydrogenase, core

    Iprscan IPR000669 [PR00084]

    164

    177

    Mannitol dehydrogenase, core

    Iprscan IPR000669 [PR00084]

    204

    217

    Mannitol dehydrogenase, core

    Iprscan IPR000669 [PR00084]

    234

    249

    Mannitol dehydrogenase, core

    Iprscan IPR013328 [G3DSA:1.10.1040.10]

    268

    451

    Dehydrogenase, multihelical

    Iprscan IPR016040 [G3DSA:3.40.50.720]

    7

    267

    NAD(P)-binding

    Iprscan IPR013131 [PF01232]

    10

    173

    Mannitol dehydrogenase, N-terminal

    Iprscan IPR013118 [PF08125]

    202

    446

    Mannitol dehydrogenase, C-terminal

    Iprscan IPR008927 [SSF48179]

    269

    460

    6-phosphogluconate dehydrogenase, C-terminal-like

    Iprscan IPR016040 [SSF51735]

    11

    268

    NAD(P)-binding

    Show or not Suggestions

    Suggest an annotation

    Move your mouse over each field to get more informations

    ID
    DE
    EC
    GO
    PM
    CC
    CL
      Your email
      Validation code (copy this one 2r94UCOP)
       

    Show or not Access unfiltered results

    pubmed

    Set of Uniprot with relevant PubMed cross-references ncbi-blastp

    N/A hits
    swiss-prot

    Swiss-Prot ncbi-blastp

    N/A hits
    trembl

    TrEMBL ncbi-blastp

    N/A hits
    trembl

    Ralstonia solanacearum str.GMI1000 proteome ncbi-blastp

    N/A hits
    hamap

    HAMAP scan

    N/A hits
    Interpro Scan

    IprScan

    N/A hits