Ralstonia solanacearum sp.

2 hits

  1. RSc1319RSc1319Bifunctional UDP-4-keto-pentose/UDP-xylose synthase
  2. RSc1449queERSc14497-carboxy-7-deazaguanine synthase

RSc1319
RSc1318
RSc1318
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Find Mutants

Find Clones
Remora
Multalin
RSc1320
RSc1320
ID
AC NP_519440.1
LT RSc1319
SY RS02842
RX strain GMI1000
OR AL646052 from 1404147 to 1405202 on strand -
DE Bifunctional UDP-4-keto-pentose/UDP-xylose synthase
IP NAD-dependent epimerase/dehydratase;
CL II.B.2 lipopolysaccharides
EC
GO Biological Process: metabolic process (GO:0008152)
Biological Process: cellular metabolic process (GO:0044237)
Molecular Function: catalytic activity (GO:0003824)
Molecular Function: coenzyme binding (GO:0050662)
Molecular Function: binding (GO:0005488)
PM
AN
SQ 351 aa
 
........10........20........30........40........50
| | | | |
MKKVLILGVNGFIGHHLSKRILESTDPEISQWEVYGMDMQTERLGDLVNH
PRMHFFEGDITINKEWVEYHVRKCDVILPLVAIATPSTYVKAPLRVFELD
FEANLPIVRSAAKYGKHLVFPSTSEVYGMCGDDEFDPEASPLVYGPINKP
RWIYACSKQLMDRVIWGYGMEGLNFTLFRPFNWIGPGLDSIHTPKEGSSR
VVTQFLGHIVRGENIQLVDGGQQKRAFTYVDDGIDALVRIIANKDGVASG
KIYNIGNPSNNYSVRELAEMMLKKAGTIAEYKENAQKVKLVETTSGAYYG
KGYQDVQNRVPKIANTMEELGWKPTTTMEDTLANIFEAYREHAAEARSLV
D
Show or not Domain decomposition
 
pubmed

3

343

S=1001 I=55 E=1.14683e-112

Bifunctional polymyxin resistance protein arnA EC=2.1.2.n1 EC=1.1.1.n1 ; Antibiotic Lipid biosynthesis Lipopolysaccharide Methyltransferase Mult

Pubmed 15583148

 

prodomImg

pubmed

3

339

S=982 I=55 E=2.57584e-110

Bifunctional polymyxin resistance protein arnA EC=2.1.2.n1 EC=1.1.1.n1 ; Antibiotic Lipid biosynthesis Lipopolysaccharide Methyltransferase Multi

Pubmed 9570402

 

prodomImg

pubmed

3

339

S=970 I=53 E=7.45608e-109

Bifunctional polymyxin resistance protein arnA EC=2.1.2.n1 EC=1.1.1.n1 ; Antibiotic Lipid biosynthesis Lipopolysaccharide Methyltransferase Multi

Pubmed 11706007

 

prodomImg

pubmed

3

346

S=556 I=36 E=1.0495e-58

UDP-D-apiose/UDP-D-xylose synthase

Pubmed 16549428

 

prodomImg

pubmed

4

346

S=552 I=36 E=3.17591e-58

Putative dTDP-glucose 4-6-dehydratase (Putative uncharacterized protein) (UDP-D-apiose/UDP-D-xylose synthase) (At2g27860/F15K20.4)

Pubmed 12969423

 

prodomImg

pubmed

162

346

S=336 I=38 E=4.25357e-32

Nucleoside-diphopshate-sugar dehydratase

Pubmed 17041024

 

prodomImg

pubmed

1

342

S=294 I=29 E=5.50219e-27

Glucuronic acid decarboxylase

Pubmed 14528002,17918933

 

prodomImg

pubmed

3

342

S=293 I=28 E=6.84223e-27

Putative UDP-glucose 4-epimerase

Pubmed 16873021

 

prodomImg

pubmed

3

340

S=283 I=29 E=1.26963e-25

DTDP-glucose 4-6-dehydratase (UDP-glucuronic acid decarboxylase)

Pubmed 10048488

 

prodomImg

pubmed

1

341

S=273 I=27 E=1.79794e-24

dTDP-glucose 4,6-dehydratase EC=4.2.1.46 ; Lyase

Pubmed 18043661

 

prodomImg

sp_Pdown

A8GDR7|ARNA_SERP5

3

339

S=1016 I=54 E=1.13791e-114

Bifunctional polymyxin resistance protein arnA [Includes: UDP-4-amino-4-deoxy-L-arabinose formyltransferase - Serratia proteamaculans (strain 568)

sp_Pdown

Q7N3Q7|ARNA_PHOLL

2

345

S=1008 I=54 E=1.06036e-113

Bifunctional polymyxin resistance protein arnA [Includes: UDP-4-amino-4-deoxy-L-arabinose formyltransferase - Photorhabdus luminescens subsp. laumondii

sp_Pdown

A0KGY6|ARNA_AERHH

1

343

S=1007 I=55 E=1.36541e-113

Bifunctional polymyxin resistance protein arnA [Includes: UDP-4-amino-4-deoxy-L-arabinose formyltransferase - Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / NCIB 9240)

sp_Pdown

A1JPN5|ARNA_YERE8

3

339

S=1003 I=55 E=5.04939e-113

Bifunctional polymyxin resistance protein arnA [Includes: UDP-4-amino-4-deoxy-L-arabinose formyltransferase - Yersinia enterocolitica serotype O:8 / biotype 1B (strain 8081)

sp_Pdown

A4TIM4|ARNA_YERPP

3

343

S=1002 I=55 E=5.80528e-113

Bifunctional polymyxin resistance protein arnA [Includes: UDP-4-amino-4-deoxy-L-arabinose formyltransferase - Yersinia pestis (strain Pestoides F)

trembl_Pdown

B2UAS2|B2UAS2_BURPI

1

351

S=1719 I=91 E=0

NAD-dependent epimerase/dehydratase - Ralstonia pickettii 12J

trembl_Pdown

A7CD54|A7CD54_BURPI

1

351

S=1719 I=91 E=0

NAD-dependent epimerase/dehydratase - Ralstonia pickettii 12D

trembl_Pdown

B1JTE2|B1JTE2_BURCC

2

351

S=1578 I=83 E=0

NAD-dependent epimerase/dehydratase - Burkholderia cenocepacia (strain MC0-3)

Iprscan IPR016040 [G3DSA:3.40.50.720]

2

285

NAD(P)-binding

Iprscan [PTHR10366]

6

347

-

Iprscan [PTHR10366:SF35]

301

347

-

Iprscan [PTHR10366:SF35]

6

285

-

Iprscan [PTHR10366:SF35]

6

347

-

Iprscan IPR001509 [PF01370]

4

256

NAD-dependent epimerase/dehydratase

Iprscan IPR016040 [SSF51735]

1

348

NAD(P)-binding

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one aIDfKfUA)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

N/A hits
swiss-prot

Swiss-Prot ncbi-blastp

N/A hits
trembl

TrEMBL ncbi-blastp

N/A hits
trembl

Ralstonia solanacearum str.GMI1000 proteome ncbi-blastp

N/A hits
hamap

HAMAP scan

N/A hits
Interpro Scan

IprScan

N/A hits
queE RSc1449
RSc1448
RSc1448
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Find Mutants

Find Clones
Remora
Multalin
RSc1450
RSc1450
ID queE
AC NP_519570.1
LT RSc1449
SY RS03858
RX strain GMI1000
OR AL646052 from 1551351 to 1551989 on strand +
DE 7-carboxy-7-deazaguanine synthase
IP Radical SAM
CL I.D.2 purine ribonucleotide biosynthesis
EC
GO Molecular Function: catalytic activity (GO:0003824)
Molecular Function: iron-sulfur cluster binding (GO:0051536)
PM
AN
SQ 212 aa
 
........10........20........30........40........50
| | | | |
MTYAVKEIFYTLQGEGANTGRAAVFCRFAGCNLWSGREADRAAAICQFCD
TDFVGTDGTLGGKYPTADALADTVAAQWPAAATGGRPLVVCTGGEPLLQL
DRPLIDALHARGFEIAIETNGTLAVPDGIDWVCVSPKMGAELVVTRGDEL
KVVIPQPGQDLDAYERLDFRHFFLQPMDGPLARRNTALAVELCQRRPRWH
LSLQTHKMLGIR
Show or not Domain decomposition
 
pubmed

2

125

S=147 I=36 E=1.87494e-09

Putative uncharacterized protein

Pubmed 8626299,8824639

 

prodomImg

pubmed

5

125

S=120 I=33 E=3.35425e-06

Putative organic radical activating enzyme

Pubmed 15793123

 

prodomImg

sp_Pdown

P45097|Y1189_HAEIN

2

212

S=212 I=31 E=1.51687e-17

Uncharacterized protein HI1189 - Haemophilus influenzae

sp_Pdown

P64556|YGCF_SHIFL

1

211

S=178 I=34 E=2.14268e-13

Uncharacterized protein ygcF - Shigella flexneri

sp_Pdown

P64554|YGCF_ECOLI

1

211

S=178 I=34 E=2.14268e-13

Uncharacterized protein ygcF - Escherichia coli (strain K12)

sp_Pdown

P64555|YGCF_ECO57

1

211

S=178 I=34 E=2.14268e-13

Uncharacterized protein ygcF - Escherichia coli O157:H7

trembl_Pdown

A7CJK7|A7CJK7_BURPI

1

212

S=1044 I=91 E=2.59543e-117

Putative uncharacterized protein - Ralstonia pickettii 12D

trembl_Pdown

B2UBF1|B2UBF1_BURPI

1

212

S=1044 I=91 E=2.71107e-117

Putative uncharacterized protein - Ralstonia pickettii 12J

trembl_Pdown

Q0KAE5|Q0KAE5_RALEH

1

212

S=943 I=83 E=5.07229e-105

Organic radical activating enzyme - Ralstonia eutropha (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) (Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337))

Iprscan IPR007197 [PF04055]

46

123

Radical SAM

Iprscan [SSF102114]

12

137

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one gf7qdMEt)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

N/A hits
swiss-prot

Swiss-Prot ncbi-blastp

N/A hits
trembl

TrEMBL ncbi-blastp

N/A hits
trembl

Ralstonia solanacearum str.GMI1000 proteome ncbi-blastp

N/A hits
hamap

HAMAP scan

N/A hits
Interpro Scan

IprScan

N/A hits