Ralstonia solanacearum sp.

  1. RSc1449queERSc14497-carboxy-7-deazaguanine synthase

queE RSc1449
RSc1448
RSc1448
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Find Mutants

Find Clones
Remora
Multalin
RSc1450
RSc1450
ID queE
AC NP_519570.1
LT RSc1449
SY RS03858
RX strain GMI1000
OR AL646052 from 1551351 to 1551989 on strand +
DE 7-carboxy-7-deazaguanine synthase
IP Radical SAM
CL I.D.2 purine ribonucleotide biosynthesis
EC
GO Molecular Function: iron-sulfur cluster binding (GO:0051536)
Molecular Function: catalytic activity (GO:0003824)
PM
AN
SQ 212 aa
 
........10........20........30........40........50
| | | | |
MTYAVKEIFYTLQGEGANTGRAAVFCRFAGCNLWSGREADRAAAICQFCD
TDFVGTDGTLGGKYPTADALADTVAAQWPAAATGGRPLVVCTGGEPLLQL
DRPLIDALHARGFEIAIETNGTLAVPDGIDWVCVSPKMGAELVVTRGDEL
KVVIPQPGQDLDAYERLDFRHFFLQPMDGPLARRNTALAVELCQRRPRWH
LSLQTHKMLGIR
Show or not Domain decomposition
 
pubmed

2

125

S=147 I=36 E=1.87494e-09

Putative uncharacterized protein

Pubmed 8626299,8824639

 

prodomImg

pubmed

5

125

S=120 I=33 E=3.35425e-06

Putative organic radical activating enzyme

Pubmed 15793123

 

prodomImg

sp_Pdown

P45097|Y1189_HAEIN

2

212

S=212 I=31 E=1.51687e-17

Uncharacterized protein HI1189 - Haemophilus influenzae

sp_Pdown

P64556|YGCF_SHIFL

1

211

S=178 I=34 E=2.14268e-13

Uncharacterized protein ygcF - Shigella flexneri

sp_Pdown

P64554|YGCF_ECOLI

1

211

S=178 I=34 E=2.14268e-13

Uncharacterized protein ygcF - Escherichia coli (strain K12)

sp_Pdown

P64555|YGCF_ECO57

1

211

S=178 I=34 E=2.14268e-13

Uncharacterized protein ygcF - Escherichia coli O157:H7

trembl_Pdown

A7CJK7|A7CJK7_BURPI

1

212

S=1044 I=91 E=2.59543e-117

Putative uncharacterized protein - Ralstonia pickettii 12D

trembl_Pdown

B2UBF1|B2UBF1_BURPI

1

212

S=1044 I=91 E=2.71107e-117

Putative uncharacterized protein - Ralstonia pickettii 12J

trembl_Pdown

Q0KAE5|Q0KAE5_RALEH

1

212

S=943 I=83 E=5.07229e-105

Organic radical activating enzyme - Ralstonia eutropha (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) (Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337))

Iprscan IPR007197 [PF04055]

46

123

Radical SAM

Iprscan [SSF102114]

12

137

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one ymmK6eCp)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

N/A hits
swiss-prot

Swiss-Prot ncbi-blastp

N/A hits
trembl

TrEMBL ncbi-blastp

N/A hits
trembl

Ralstonia solanacearum str.GMI1000 proteome ncbi-blastp

N/A hits
hamap

HAMAP scan

N/A hits
Interpro Scan

IprScan

N/A hits