Ralstonia solanacearum sp.

  1. RSc0869RSc0869putative cytosine-specific methyltransferase protein

RSc0869
RSc0868
RSc0868
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Find Mutants

Find Clones
Remora
Multalin
RSc0870
RSc0870
ID
AC NP_518990.1
LT RSc0869
SY RS04946
RX strain GMI1000
OR AL646052 from 903269 to 904393 on strand +
DE putative cytosine-specific methyltransferase protein
IP C-5 cytosine-specific DNA methylase
CL II.B.8 DNA - replication, repair, restr./modif.
EC
GO Biological Process: DNA methylation (GO:0006306)
Molecular Function: DNA binding (GO:0003677)
PM
AN
SQ 375 aa
 
........10........20........30........40........50
| | | | |
MGAYYNEIDPYAAAWLRNLIAAGHIAPGDVDERDIQDVRPEDLRGYKQHH
FFAGVGVWSLALRRAGWPDDRLVWTGSCPCQPFSQAGKGLAFADERHLWP
AWYHLISECRPAVVLGEQVASNNADTWIDLVQDDMEAVGHAFGAVPFPAA
GVGAPHIRDRLYWVAYADGSRSRRYSRAVRRAKAEINREGSEDGSNPDGF
ELGRTNGRLAHSLPAGRTEGRPFAGNRSPSGLCVVGGLADTNGGYTGAER
QQRCGQQRQQPEDGGIGLGLGHAEREGLALGQRLARVPGAASGTDPRQAV
ERAGIHVASGPGPTNGLWRDADWLLCRDGRWRPVEPGAFPLAHGAPARVG
RLRAYGNAICASAAQAFIESVMAWL
Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one AjPD108y)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

N/A hits
swiss-prot

Swiss-Prot ncbi-blastp

N/A hits
trembl

TrEMBL ncbi-blastp

N/A hits
trembl

Ralstonia solanacearum str.GMI1000 proteome ncbi-blastp

N/A hits
hamap

HAMAP scan

N/A hits
Interpro Scan

IprScan

N/A hits