Ralstonia solanacearum sp.

  1. RSc0050RSc0050N-acteyl-D-glucosamine oxidase

RSc0050
RSc0049
RSc0049
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Narcisse
StringString database Find Mutants

Find Clones
Remora
Multalin
RSc0051
RSc0051
ID
AC NP_518171.1
LT RSc0050
SY RS01873
RX strain GMI1000
OR AL646052 from 54450 to 55976 on strand -
DE N-acteyl-D-glucosamine oxidase
IP FAD linked oxidase, N-terminal; Berberine/berberine-like;
CL I Small Molecule Metabolism
EC
GO Molecular Function: oxidoreductase activity (GO:0016491)
Molecular Function: catalytic activity (GO:0003824)
Molecular Function: FAD binding (GO:0050660)
PM
AN voir https://doi.org/10.1002/cbic.202100510
SQ 508 aa
 
........10........20........30........40........50
| | | | |
MTLDVTRQDPRYDTLRHGFNLRWPSSDAQAAGRIALCEKTDEVAPALQRI
IDTGMRPTVRSGGHCYEDFVSNNPGGVIVDLSLLNAPEVRADGAVRVPAG
MQNWNGALELYKRHGVTLPGGSCYSVGAGGHISGGGYGLLSRLQGLTVDW
LSAVDIVTVDKQGRAAPRTVDAARDPDLFRACRGAGGGNFGIITSYTFAR
LPEAPREVALATVAFDWAAMTPERFAELLRLYGDYWATRGKDPDTWGLFS
LLKLTHKSAGQIVMLTQFCNPDGTCRDLSVLNDFLARFQVCAPVPARARP
PGYGPAHRQGVGQLLCSKPHTVVQYDWLTATQSLNGSGPNQRGKYKSAYM
KRGFTAREAQRIYTHLTRTVQGIDLSQSLLQVDSYGGAVNKAERIADTAV
PQRASVMKLQYQTYWTSAADDAGHLRWIGDFYRDVYGTPDVSAPHAGTPY
PGDRYEGCYINYPDVDMLAYPFWPQLYYGDGDLYAFLQRVKRRYDPNNIF
HHAMSVRP
Show or not Domain decomposition
 
pubmed

7

506

S=597 I=34 E=2.01817e-63

Hexose oxidase

Pubmed 9111074

 

prodomImg

pubmed

3

508

S=511 I=36 E=4.54215e-53

Putative hexose oxidase

Pubmed 12837387

 

prodomImg

pubmed

7

508

S=465 I=34 E=1.74726e-47

AclO

Pubmed 12399480

 

prodomImg

pubmed

3

508

S=463 I=33 E=2.74951e-47

Aclacinomycin oxidoreductase

Pubmed 12137949

 

prodomImg

pubmed

5

506

S=428 I=32 E=5.90224e-43

Putative oxidoreductase

Pubmed 12822997

 

prodomImg

pubmed

327

508

S=296 I=41 E=5.43152e-27

Putative oxidoreductase

Pubmed 11358695

 

prodomImg

pubmed

3

264

S=265 I=33 E=2.67155e-23

Putative oxidoreductase

Pubmed 11358695

 

prodomImg

pubmed

342

508

S=279 I=42 E=5.6149e-25

Dehydrogenase

Pubmed 16751529

 

prodomImg

pubmed

5

268

S=275 I=37 E=2.13146e-24

Dehydrogenase

Pubmed 16751529

 

prodomImg

pubmed

5

271

S=209 I=30 E=1.99191e-16

Hypothetical 54.4 kd protein

Pubmed 9202460

 

prodomImg

sp_Pdown

P08159|HDNO_ARTOX

23

229

S=132 I=29 E=2.17494e-07

6-hydroxy-D-nicotine oxidase - Arthrobacter oxidans

trembl_Pdown

A7CCH7|A7CCH7_BURPI

1

507

S=2275 I=83 E=0

Berberine/berberine domain protein - Ralstonia pickettii 12D

trembl_Pdown

B2U7W5|B2U7W5_BURPI

1

507

S=2268 I=83 E=0

Berberine/berberine domain protein - Ralstonia pickettii 12J

trembl_Pdown

Q7CKP6|Q7CKP6_YERPE

5

506

S=840 I=40 E=4.67239e-92

Putative uncharacterized protein - Yersinia pestis

Iprscan IPR006094 [PF01565]

31

160

FAD linked oxidase, N-terminal

Iprscan IPR012951 [PF08031]

458

507

Berberine/berberine-like

Iprscan IPR016166 [SSF56176]

2

202

FAD-binding, type 2

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one uqqJT0hh)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

N/A hits
swiss-prot

Swiss-Prot ncbi-blastp

N/A hits
trembl

TrEMBL ncbi-blastp

N/A hits
trembl

Ralstonia solanacearum str.GMI1000 proteome ncbi-blastp

N/A hits
hamap

HAMAP scan

N/A hits
Interpro Scan

IprScan

N/A hits