Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_plc00480xfutal2XFF4834R_plc00480probable TAL effector avirulence AvrBs3/pth family protein, type III effector, TAL effector XfuTAL2

xfutal2 XFF4834R_plc00480
XFF4834R_plc_0049
XFF4834R_plc_0049
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_plc00010
XFF4834R_plc00010
ID xfutal2
AC XFF4834R_plc00480
LT XFF4834R_plc00480
OR XFF4834R_plc from 38709 to 41843 on strand +
DE probable TAL effector avirulence AvrBs3/pth family protein, type III effector, TAL effector XfuTAL2
IP Avirulence protein PthA-related, Xanthomonas species; Thiolase-like
CL 5.13 Virulence associated GO:0009405
EC
GO InterPro
Biological Process: metabolic process (GO:0008152)
Molecular Function: catalytic activity (GO:0003824)

Curated
PM
AN MODIF ADMIN: +1 du chromosome decalle de 1kb. start modifie. Ajout de 18aa. bon usage de codon. coherent avec orthogues de X.aurantifolii. Il ne s agit pas de l integralite de la proteine. La partie C-terminale se trouve au niveau de l ORF XFF4834R pl3 0001
CC COG: [NST] Cell motility;Function unknown;Signal transduction mechanisms;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20130514)
MW 109779.9 Da
SQ 1044 aa
 
........10........20........30........40........50
| | | | |
MSAFGAPHTEAASGEGDEVQSGLRAADDPQATVQVAVTAARPPRAKPAPR
RRAAHTSDASPAGQVDLCTLGYSQQQQEKIKLKARPIVAQHHEALIGHGF
TRAHIVALSQHPAALGTVAVKYQAMIAALPEATHEDIVGVGKQWSGARAL
EALLTVSGELRGPPLQLDTGQLLKIAKRGGVTAVEAVHAWRNALTGVPLN
LTPDQVVAIASNIGGKQALETVQLLLPVLCEQHGLTPDQVVAIASNGGGK
QALETVQRLLPVLCKDHGLTPAQVVAIANHDGGKQALETVQRLLPVLCKD
HGLTPAQVVAIASNGGGKQALETVEQLLPVLCKDHGLTPDQVVAIANHDG
GKPALETVQRLLPVLCQELGLTPDQVVAIASNIGGKQALETVQRLLPVLC
QELGLTPDQVVAIASNGGAKQALETVQRLLPVLCQELGLTPAQVVAIASN
IGGKQALETVERLLPVLCQELGMTLAQVVAIASHYGGKQALEAVQRLLPV
LCQELGLTPDQVVAIASNNGGKQALETVQRLLPVLCEQHGLTPDQVVAIA
SNGGKQALETVQRLLPVLCEQHGLTPDQVVAIASHDGGKQALETVERLLP
VLCQELGMTLAQVVAIASNGGGKQALETVERLLPVLCQELGMTLAQVVAI
ASHYGGKQALEAVQRLLPVLCQDLGLTPDQVVAIASNNGGKQALETVQRL
LPVLCEQHGLTPDQVVAIASHDGGKQALEAVQRLLPVLCQDHGLNPDQVV
AIASNGGGRQALESIFAQLSRPDQALAALTNDHLVALACLGGCPALEAVK
KGLPHALTLIKRTSRRLPERTSHRVADHAQVARVLGFFQCHSHPAQAFDE
AMAQFAMSRHGLLQLFRRVGVTELEACNGTLPPASQRWHRILQASGVRTA
TPSRASAQTPDQASLDAFADALERGLDALSPIDQAVQAQASSRRKRSRSE
SSVTRSSAHYAVEVPVREQHAALDSLPPSWGAKRPRTRIGGGLADPGTPM
HGDLAASSTVAWEHDAAPFAAAEAGDFPAFNDEEIAWLMELFPQ
Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one FXZqMn99)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

233 hits
swiss-prot

Swiss-Prot ncbi-blastp

2 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

8 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

7 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBk4unnJ/XFF4834R_plc00480.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBk4unnJ/XFF4834R_plc00480.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBk4unnJ/XFF4834R_plc00480.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBk4unnJ/XFF4834R_plc00480.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.