Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_plc00360XFF4834R_plc_0030113_0031384_r1_XFF4834R-XFF4834R_plc00360XFF4834R_plc00360putative lytic murein transglycosylase

XFF4834R_plc_0030113_0031384_r1_XFF4834R-XFF4834R_plc00360 XFF4834R_plc00360
XFF4834R_plc00360
XFF4834R_plc00360
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_plc00380
XFF4834R_plc00380
ID XFF4834R_plc_0030113_0031384_r1_XFF4834R-XFF4834R_plc00360
AC XFF4834R_plc00360
LT XFF4834R_plc00360
OR XFF4834R_plc from 29113 to 30390 on strand -
DE putative lytic murein transglycosylase
IP Peptidoglycan binding-like; Lytic murein transglycosylase
CL 1.7.34 Peptidoglycan (murein) turnover, recycling GO:0000270
EC
GO InterPro
Biological Process: metabolic process (GO:0008152)

Curated
PM
AN start change (multialign)
CC COG: [M] Cell wall/membrane/envelope biogenesis;
CC MODEL: XFF4834R
CC STATUS: curated by irobene (20100823)
MW 46303.5 Da
SQ 425 aa
 
........10........20........30........40........50
| | | | |
MIMPSRLLRLSLGVSVCVAATSVAAQAIAPQTTASSATEVSAQQQDPAPT
ASFEQWLADFRQRALAAGIEATTLDNALAGVTPDPSVHELDQQQPEFTQY
LWDYLDARVTPSAIQEGQQLLISQHALFQKLRQHYGVDPGILTAIWSMES
GYGKQIGDFYVIRSLATLAHEGRRTTYGNTQLLAALQILQTEKNIDRSQL
VGSWAGAMGQTQFIPSTYRDYAVDEDGDQKRDVWNSKADALGSAANYLKQ
SNWTSAVPWGQEVQLSAGFDYAQADLTIKKTVAEWQRLGVAPHRPIAPTL
AQQLASVLLPTGYRGPAFLVFDNFRSILRYNNSTAYALAVGLLADGYAGR
AGVEQSWPKDDPPLNSTAQITELQQRLTDKGFDVGGIDGVLGARTRQGIR
AFQRSQQLPQDGYASTSLLARLRAA
XFF4834R

XFF4834R_chr41640 lcl|XFF4834R_chr_4843538_4845694_r3_XFF4834R-XFF4834R_chr41640

52

412

S=656 I=41 E=7.09043e-73

conserved protein

XFF4834R

XFF4834R_chr06710 lcl|mltB-XFF4834R_chr06710

53

350

S=268 I=30 E=7.50375e-26

membrane-bound lytic murein transglycosylase B

X.species

NP_643533.1 lcl|mltB-XAC3225

1

417

S=1916 I=88 E=0

transglycosylase

X.species

NP_644735.1 lcl|mlt-XACb0007

1

417

S=1910 I=88 E=0

lytic murein transglycosylase

X.species

YP_364171.1 lcl|hpaJ-XCV2440

1

417

S=1908 I=88 E=0

lytic murein transglycosylase precursor

X.species

lcl|XALc_1923

1

417

S=1652 I=77 E=0

probable lytic murein transglycosylase precursor transmembrane protein

X.species

YP_366126.1 lcl|XCV4395

52

412

S=686 I=42 E=6.23256e-76

putative transglycosylase precursor

X.species

NP_644590.2 lcl|XAC4296-XAC4296

52

412

S=679 I=42 E=4.09781e-75

epimerase

X.species

NP_639491.1 lcl|XCC4157

52

414

S=672 I=42 E=2.88887e-74

epimerase

X.species

lcl|XALc_3122

52

414

S=656 I=42 E=2.90931e-72

putative membrane bound lytic murein transglycosylase b transmembrane protein

X.species

lcl|mltB-XALc_0812

40

350

S=295 I=30 E=1.37195e-28

probable membrane-bound lytic murein transglycosylase protein

X.species

NP_638804.1 lcl|mltB-XCC3458

53

350

S=271 I=30 E=1.22187e-25

membrane-bound lytic transglycosylase

X.species

NP_641015.1 lcl|mltB-XAC0662

53

350

S=267 I=29 E=3.69753e-25

membrane-bound lytic transglycosylase

X.species

YP_362454.1 lcl|mltB-XCV0723

53

350

S=266 I=29 E=5.1052e-25

membrane-bound lytic transglycosylase

pubmed

1

417

S=1908 I=88 E=0

Putative murein transglycosylase ; Signal

Pubmed 14645268

 

prodomImg

pubmed

51

416

S=1147 I=60 E=4.33864e-130

Type III effector HopPmaG

Pubmed 11872842

 

prodomImg

pubmed

51

413

S=664 I=39 E=1.15645e-71

Translycolase-related protein

Pubmed 18773201

 

prodomImg

pubmed

199

413

S=546 I=52 E=2.57154e-57

Putative uncharacterized protein

Pubmed 14964532

 

prodomImg

pubmed

103

345

S=379 I=34 E=4.82104e-37

Putative transglycosylase

Pubmed 10673051

 

prodomImg

sp

104

340

S=262 I=32 E=4.03149e-23

Membrane-bound lytic murein transglycosylase B EC=4.2.2.n1 ; Cell outer wall biogenesis/degradation Lipoprotein Lyase Palmitate Signal

 

prodomImg

Iprscan [G3DSA:1.10.530.10]

96

347

-

Iprscan IPR002477 [G3DSA:1.10.101.10]

367

422

Peptidoglycan binding-like

Iprscan IPR002477 [PF01471]

368

422

Peptidoglycan binding-like

Iprscan IPR011970 [TIGR02283]

52

349

Lytic murein transglycosylase

Iprscan [seg]

5

12

-

Iprscan [seg]

14

29

-

Iprscan [seg]

181

190

-

Iprscan [seg]

418

425

-

Iprscan [SignalP-NN(euk)]

1

25

-

PD135920

53

196

S=249 I=39 E=1.19511e-22

PD379248

305

351

S=137 I=64 E=4.04193e-09

PD604396

1

56

S=125 I=48 E=1.33345e-07

PD580287

201

248

S=114 I=56 E=2.26773e-06

PD005187

372

412

S=111 I=55 E=5.61549e-06

Iprscan [SSF53955]

36

353

-

Iprscan IPR002477 [SSF47090]

351

423

Peptidoglycan binding-like

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one hlMhTxi0)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

11 hits
swiss-prot

Swiss-Prot ncbi-blastp

1 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

3 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

11 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBNOGD4z/XFF4834R_plc00360.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBNOGD4z/XFF4834R_plc00360.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBNOGD4z/XFF4834R_plc00360.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBNOGD4z/XFF4834R_plc00360.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.