Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_plc00310xopC1XFF4834R_plc00310Xanthomonas outer protein C1, Type III effector XopC1

xopC1 XFF4834R_plc00310
XFF4834R_plc_0030
XFF4834R_plc_0030
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_plc00330
XFF4834R_plc00330
ID xopC1
AC XFF4834R_plc00310
LT XFF4834R_plc00310
OR XFF4834R_plc from 23489 to 25993 on strand +
DE Xanthomonas outer protein C1, Type III effector XopC1
IP Phosphoribosyltransferase
CL 5.13 Virulence associated GO:0009405
EC
GO InterPro
Biological Process: nucleoside metabolic process (GO:0009116)

Curated
PM
AN outer protein C1
CC COG: [R] General function prediction only;
CC MODEL: XFF4834R
CC STATUS: curated by boureau (20110713)
MW 91997 Da
SQ 834 aa
 
........10........20........30........40........50
| | | | |
MKTIGVSKSHDLSQFPEGDLKPKISIPVGRHSEIPKDAALSAELRGLRSL
ERKPSKIQNSSSDLQAVNKMIAEHRSNDVGKGQFLLPTQSLGSAERVDSQ
NYHSRNESGKAPFFFSEFATEKPSLQSVKSLSQGKQDYYAVRHVGKRGRD
LFTDEPIEGENSKLGRLKTSPLLSTQSQGTRAIRAFAATATIDKSRGEYV
ARLHRHVVEALGDEGGVVHLLRPTRDHYAEDSTLNFFTFCEQTELASSLN
SLEASSAKEKGRKPIVFTDHKSLVGLSRTSRTEASPIGRLVQQPYFVTSD
LKRGDKVVITDDHIQAGGSMLAMEAAAKEAGVDVLALATLSAHPFSPQLT
MSSEVSAFLDETLAAWDPQAKVTERLAAIGMPREKLTNSEAMILIAYAID
PASDSAISRFESIQNNLFERAHLHNVGIDPDAPDTLEKMQKLRSMQEMAG
TDSARHFIDDAKVLEGEHDSLIPILKMKPASPDEIVKELDQVSLASRSSI
QASEVKQVVVLDWDDCLRDEKGLNYKLMHNALAIAAREHASTLPELGDAV
AVLHSKLNDAGPVDDEAPLLMKNQKDFSSYLMGRPSIYKRHIIEDFVRKM
LPGISEHKAASINNAVYSNFVREYKRLVKPEISKKNYSRDVPFPDIELSL
LPGAKEILEKSRNANSRVILISNRGHGDLENEINHLGMMHYFDVVSGAEE
VTLEKSHFPPSQMPEDLQKRLINSLNGSDEEALRATLSETAIYAHPDSTA
IGRIDKKPDSTRLAESLERLSVQPNVPITSYGDQPSDIKQLKNVAEPKSR
VLKGVIVNAQRDDVGREIDVDGVPTRVVSKITEL
X.species

YP_364166.1 xopC-XCV2435

1

834

S=4028 I=92 E=0

outer protein C

pubmed

1

834

S=4028 I=92 E=0

Type III effector XopC

Pubmed 14645268

 

prodomImg

Iprscan [G3DSA:3.40.50.1000]

628

707

-

Iprscan IPR000836 [PF00156]

298

340

Phosphoribosyltransferase

Iprscan [seg]

180

192

-

Iprscan [seg]

244

259

-

PDA07878

236

471

S=1120 I=90 E=3.85804e-128

PD563010

472

702

S=816 I=69 E=2.73296e-91

PD534231

97

235

S=534 I=70 E=4.48222e-57

PD483458

705

834

S=416 I=62 E=9.70959e-43

PDA0V6F1

1

96

S=388 I=79 E=2.14134e-39

Iprscan [SSF56784]

507

707

-

Iprscan [SSF53271]

295

360

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one KqHqKfsF)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

1 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

6 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBPjKOGI/XFF4834R_plc00310.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBPjKOGI/XFF4834R_plc00310.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBPjKOGI/XFF4834R_plc00310.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBPjKOGI/XFF4834R_plc00310.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.