Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_plc00240XFF4834R_plc00240Probable Type II restriction endonuclease XcyI

XFF4834R_plc00240
XFF4834R_plc00230
XFF4834R_plc00230
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_plc_0025
XFF4834R_plc_0025
ID
AC XFF4834R_plc00240
LT XFF4834R_plc00240
OR XFF4834R_plc from 18106 to 19107 on strand +
DE Probable Type II restriction endonuclease XcyI
IP Restriction endonuclease, type II, XcyI
CL 2.1.2 DNA restriction/modification GO:0006304 GO:0009307
EC
GO InterPro
Biological Process: DNA restriction-modification system (GO:0009307)
Molecular Function: DNA binding (GO:0003677)
Molecular Function: Type II site-specific deoxyribonuclease activity (GO:0009036)
Molecular Function: magnesium ion binding (GO:0000287)

Curated
PM
AN
CC COG: [S] Function unknown;
CC MODEL: XFF4834R
CC STATUS: curated by szurek (20101122)
MW 36765.7 Da
SQ 333 aa
 
........10........20........30........40........50
| | | | |
MTTPNKINFPPPKLQIDFAFALKRFRAVYLQSALLETVRDMDIAELDRQL
SKYVPPADLATLAQYGLRAELLFAVPAVLEANPHLLGYYRLLMGYSQKEF
YGRDKGFGVGCFKSMEEKGKAGKAAVADLHDLCVAFCAAASALLAGVGPL
RVSRELLDDLTLLTVGPQLRGGANNQRGADGIVLVFEIIREIVAHAAAEV
RESAIEVNSATGRPVLIEFAPDPDIIIREEMEHQHYRNVVAIEVKSGTDV
SNIHNRIGEAEKSHQKARQRGFTECWTVVNVGRLDMVKARSESPSTDRFY
SLTALSLRAGDEYDDFRRRVLSLTAIPARPANP
Show or not Domain decomposition
 
pubmed

1

333

S=1546 I=92 E=1.15447e-178

Probable restriction endonuclease R.XmaI ; Plasmid

Pubmed 16697042

 

prodomImg

pubmed

1

333

S=1532 I=91 E=6.09879e-177

Type-2 restriction enzyme XcyI EC=3.1.21.4 ; Endonuclease Hydrolase Magnesium system

Pubmed 1475187

 

prodomImg

pubmed

1

333

S=1482 I=88 E=6.79661e-171

Pac25I endonuclease ; Plasmid

Pubmed 9742696,9465390

 

prodomImg

pubmed

5

330

S=1225 I=75 E=9.80487e-140

Type-2 restriction enzyme Cfr9I EC=3.1.21.4 ; Endonuclease Hydrolase Magnesium system

Pubmed 8163180

 

prodomImg

sp

1

333

S=1532 I=91 E=4.20085e-177

Type-2 restriction enzyme XcyI EC=3.1.21.4 ; Endonuclease Hydrolase Magnesium system

 

prodomImg

sp

5

330

S=1225 I=75 E=6.7536e-140

Type-2 restriction enzyme Cfr9I EC=3.1.21.4 ; Endonuclease Hydrolase Magnesium system

 

prodomImg

Iprscan IPR019071 [PF09571]

10

327

Restriction endonuclease, type II, XcyI

Iprscan [seg]

116

125

-

Iprscan [seg]

133

148

-

PDA1S0B1

149

327

S=664 I=76 E=5.80968e-73

PD017942

10

114

S=498 I=90 E=9.0695e-53

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one J4CK6OYr)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

4 hits
swiss-prot

Swiss-Prot ncbi-blastp

2 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

3 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBTf94Kw/XFF4834R_plc00240.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBTf94Kw/XFF4834R_plc00240.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBTf94Kw/XFF4834R_plc00240.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBTf94Kw/XFF4834R_plc00240.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.