Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_plc00230XFF4834R_plc00170207_0019109_f3_XFF4834R-XFF4834R_plc00230XFF4834R_plc00230 Site-specific DNA-methyltransferase (cytosine-N(4)-specific).

XFF4834R_plc00170207_0019109_f3_XFF4834R-XFF4834R_plc00230 XFF4834R_plc00230
XFF4834R_plc00220
XFF4834R_plc00220
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_plc00240
XFF4834R_plc00240
ID XFF4834R_plc00170207_0019109_f3_XFF4834R-XFF4834R_plc00230
AC XFF4834R_plc00230
LT XFF4834R_plc00230
OR XFF4834R_plc from 17207 to 18109 on strand +
DE Site-specific DNA-methyltransferase (cytosine-N(4)-specific).
IP DNA methylase N-4/N-6; DNA methylase, N-4 cytosine-specific, conserved site
CL 2.1 DNA related GO:0006259
EC
GO InterPro
Biological Process: DNA methylation on cytosine (GO:0032776)
Biological Process: DNA methylation (GO:0006306)
Molecular Function: site-specific DNA-methyltransferase (cytosine-N4-specific) activity (GO:0015667)
Molecular Function: DNA binding (GO:0003677)
Molecular Function: N-methyltransferase activity (GO:0008170)

Curated
PM
AN
CC COG: [L] Replication, recombination and repair;
CC MODEL: XFF4834R
CC STATUS: curated by royer (20101104)
MW 33517.9 Da
SQ 300 aa
 
........10........20........30........40........50
| | | | |
MPKANTSPPSGVERILRPEPLILRGSTLFEGDALTVLRRLPSGSVRCVVT
SPPYWGLRDYGIEEQIGLEVTMPQFLHRLVAIFAEVKRVLTDDGTLWLNI
GDGYTSGNRGYRAPDKKNPARAMDVRPDTPVGLKPKDLMGIPWRLAFALQ
DDGWYLRSDIVWNKPNAMPESVKDRPARSHEFLFMFTKSEKYFYDWQAAR
EPADGGGLRNRRSVWNVNTKPFAGAHFATFPPELIRPCIHASTEPGDYVL
DPFFGSGTVGLVCQDENRQYVGIELNPEYVTLAAGRLQGQNSNVIKIAAA
XFF4834R

XFF4834R_chr06850 lcl|XFF4834R_chr_0785773_0786837_f1_XFF4834R-XFF4834R_chr06850

235

288

S=98 I=39 E=1.9731e-05

X.species

YP_362841.1 lcl|XCV1110

28

293

S=884 I=60 E=3.84952e-100

site-specific DNA-methyltransferase (cytosine-N(4)-specific)

X.species

lcl|XALc_2394

207

288

S=129 I=34 E=1.26313e-08

putative adn methyltransferase protein

X.species

lcl|XALc_2626

207

288

S=126 I=34 E=2.94264e-08

putative dna modification methylase protein

X.species

NP_642950.1 lcl|XAC2639-XAC2639

226

287

S=113 I=42 E=1.0873e-06

site-specific DNA-methyltransferase

X.species

NP_636443.1 lcl|XCC1068

234

289

S=102 I=36 E=2.48717e-05

DNA methylase

pubmed

1

300

S=1582 I=99 E=0

Probable DNA modification methyltransferase M.XmaI ; Plasmid

Pubmed 16697042

 

prodomImg

pubmed

1

300

S=1578 I=99 E=0

Modification methylase XcyI EC=2.1.1.113 ; Methyltransferase Restriction system S-adenosyl-L-methionine

Pubmed 1475187

 

prodomImg

pubmed

1

300

S=1502 I=94 E=2.45138e-173

Pac25I methylase ; Methyltransferase Plasmid

Pubmed 9742696,9465390

 

prodomImg

pubmed

12

300

S=1333 I=84 E=6.02199e-153

Modification methylase Cfr9I EC=2.1.1.113 ; Methyltransferase Restriction system S-adenosyl-L-methionine

Pubmed 2690010,8163180

 

prodomImg

pubmed

28

293

S=884 I=60 E=1.43793e-98

XveII methyltransferase

Pubmed 17488332

 

prodomImg

pubmed

23

287

S=864 I=58 E=4.86546e-96

Modification methylase SmaI EC=2.1.1.113 ; Methyltransferase Restriction system S-adenosyl-L-methionine

Pubmed 2690008,2251121

 

prodomImg

pubmed

26

288

S=848 I=59 E=3.70695e-94

DNA modification methylase ; Methyltransferase Plasmid

Pubmed 18241920

 

prodomImg

pubmed

31

202

S=467 I=49 E=6.17851e-48

Modification DNA methylase ; Methyltransferase

Pubmed 18990191

 

prodomImg

pubmed

208

287

S=249 I=54 E=1.34838e-21

Modification DNA methylase ; Methyltransferase

Pubmed 18990191

 

prodomImg

pubmed

31

206

S=448 I=49 E=9.79137e-46

Gp56

Pubmed 12081973

 

prodomImg

sp

1

300

S=1578 I=99 E=0

Modification methylase XcyI EC=2.1.1.113 ; Methyltransferase Restriction system S-adenosyl-L-methionine

 

prodomImg

sp

12

300

S=1333 I=84 E=4.1492e-153

Modification methylase Cfr9I EC=2.1.1.113 ; Methyltransferase Restriction system S-adenosyl-L-methionine

 

prodomImg

sp

23

287

S=864 I=58 E=3.35234e-96

Modification methylase SmaI EC=2.1.1.113 ; Methyltransferase Restriction system S-adenosyl-L-methionine

 

prodomImg

sp

28

212

S=375 I=44 E=5.29136e-37

Modification methylase SfiI EC=2.1.1.113 ; Methyltransferase Restriction system S-adenosyl-L-methionine

 

prodomImg

sp

209

281

S=116 I=33 E=1.24383e-05

Modification methylase SfiI EC=2.1.1.113 ; Methyltransferase Restriction system S-adenosyl-L-methionine

 

prodomImg

Iprscan [G3DSA:3.40.50.150]

12

287

-

Iprscan IPR002941 [PF01555]

45

285

DNA methylase N-4/N-6

Iprscan IPR017985 [PS00093]

49

54

DNA methylase, N-4 cytosine-specific, conserved site

PD527906

17

107

S=313 I=67 E=1.56897e-30

PD521434

132

208

S=201 I=48 E=5.89161e-17

PD001370

212

288

S=161 I=47 E=4.80099e-12

PDA995G8

45

200

S=133 I=25 E=1.01364e-08

PD869579

1

27

S=131 I=96 E=1.94926e-08

PDA1K087

109

138

S=120 I=83 E=4.01594e-07

PD098433

225

288

S=111 I=44 E=5.07762e-06

PDA651S0

1

27

S=108 I=81 E=1.15237e-05

PDA1E301

31

65

S=101 I=60 E=8.41231e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one lk66Kgpx)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

65 hits
swiss-prot

Swiss-Prot ncbi-blastp

34 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

3 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBezw2TB/XFF4834R_plc00230.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBezw2TB/XFF4834R_plc00230.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBezw2TB/XFF4834R_plc00230.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBezw2TB/XFF4834R_plc00230.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.