Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_pla00510xfutal1XFF4834R_pla00510probable avirulence avrBs3/pth family protein, type III effector, TAL effector Xfutal1

xfutal1 XFF4834R_pla00510
XFF4834R_pla_0054
XFF4834R_pla_0054
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_pla00010
XFF4834R_pla00010
ID xfutal1
AC XFF4834R_pla00510
LT XFF4834R_pla00510
OR XFF4834R_pla from 40541 to 45205 on strand +
DE probable avirulence avrBs3/pth family protein, type III effector, TAL effector Xfutal1
IP Avirulence protein PthA-related, Xanthomonas species; Thiolase-like
CL 5.13 Virulence associated GO:0009405
EC
GO InterPro
Biological Process: metabolic process (GO:0008152)
Molecular Function: catalytic activity (GO:0003824)

Curated
PM
AN start modifie. ajout de 18aa. usage codon conserve
CC COG: [NST] Cell motility;Function unknown;Signal transduction mechanisms;
CC MODEL: XFF4834R
CC STATUS: curated by boureau (20130320)
MW 164841.9 Da
SQ 1554 aa
 
........10........20........30........40........50
| | | | |
MSAFGAPHTEAASGEGDEVQSGLRAADDPQATVQVAVTAARPPRAKPVPR
RRAAHTSDASPAGQVDLCTLGYSQQQQEKIKLKARSTVAQHHEALIGHGF
TRAQIVALSQHPAALGTVAVKYQVMIAALPEATHEDIVGVGKQWSGARAL
EALLTVSGELRGPPLQLDTGQLLKIAKRGGVTAVEAVHAWRNALTGAPLN
LTPDQVVAIASNIGGKQALETVQRLLPVLCEQHGLTREQVVAIASNNGGK
QALETVQRLLPVLCEQHGLTPAQVVAIASNNGGKQALETVQRLLPVLCEQ
HGLTPEQVVAIASHDGGKQALETVQRLLPVLCEQHGLTPEQVVAIASNIG
GKQALETVQRLLPVLCEQHGLTPDQVVAIASHDGGKQALETVQRLLPVLC
EQHGLTREQVVAIASNIGGKQALETVQRLLPVLCEQHGLTPEQVVAIASH
DGGKQALETVQRLLPVLCEQHGLTPEQVVAIASHDGGKQALETVQRLLPV
LCQAHGLTPEQVVAIASHDGGKQALETVQRLLPVLCHAHGLTPEQVVAIA
SHDGGKQALETVQRLLPVLCEQHGLTPAQVVAIASHDGGKQALETVQRLL
PVLCEQHGLTPDQVVAIASNIGGKQALETVQRLLPVLCEQHGLTPDQVVA
IASNGGGKQALETVQRLLPVLCEQHGLTPDQVVAIASNIGGKQALETVQR
LLPVLCEQHGLTPEQVVAIASNGGGKQALETVQRLLPVLCQAHGLTPDQV
VAIASNIGGKQALETVQRLLPVLCEQHGLTPDQVVAIASNNGGKQALETV
QRLLPVLCEQHGLTPDQVVAIASNGGGKQALETVQRLLPVLCEQHGLTRE
QVVAILCNNGGKQALETVQRLLPVLCQAHGLFPEQVVAIASHDGGKQALE
TLQRLLPVLCEQHGLTREQVVAIASHDGGKQALETLQRLLPVLCEQHGLT
PEQVVAIASNFGGKQALETVQRLLPVLCEQHGLTPDQVVAIASHDGGKQA
LETVQRLLPVLCEQHGLTREQVVAIASNIGGKQALETVQRLLPVLCEQHG
LTPEQVVAIASHDGGKQALETVQRLLPVLCEQHGLTPEQVVAIASHDGGK
QALETVQRLLPVLCQAHGLTPEQVVAIASHDGGKQALETVQRLLPVLCQA
HGLTPEQVVAIASHDGGKQALETVQRLLPVLCEQHGLTREQVVAIASHDG
GKQALETVQRLLPVLCQAHGLTPEQVVAIASNGGGKQALETVQRLLPVLC
EQHGLTPAQVVAIASNGGGKQALESIFAQLSRPDQALAALTNDHLVALAC
LGGRPALEAVKKGLPHAPTLIKRTNRRLPERTSHRVADHAQVARVLGFFQ
CHSHPAQAFDEAMTQFGMSRHGLLQLFRRVGVTELEARSGTLPPAPQRWH
RILQASGMKRAEPSGASAQTPDQASLHAFADALERELDAPSPIDRAGQAL
ASSSRKRSRSESSVTGSFAQQAVEVRVPEQHEGLHFPPLSWGVKRPRTRI
GGGLPDPGTPMDADLAASSTMIWEQDAAPFVGEEDDFPAFNEEEMAWLME
LFPQ
Show or not Domain decomposition
 
XFF4834R

XFF4834R_plc00480 lcl|XFF4834R_plc00390763_0041950_f1_XFF4834R-XFF4834R_plc00480

19

748

S=2961 I=84 E=0

XFF4834R

XFF4834R_plc00480 lcl|XFF4834R_plc00390763_0041950_f1_XFF4834R-XFF4834R_plc00480

505

1156

S=2284 I=75 E=0

XFF4834R

XFF4834R_plc00480 lcl|XFF4834R_plc00390763_0041950_f1_XFF4834R-XFF4834R_plc00480

335

986

S=2258 I=75 E=0

XFF4834R

XFF4834R_plc00480 lcl|XFF4834R_plc00390763_0041950_f1_XFF4834R-XFF4834R_plc00480

573

1224

S=2238 I=74 E=0

XFF4834R

XFF4834R_plc00480 lcl|XFF4834R_plc00390763_0041950_f1_XFF4834R-XFF4834R_plc00480

539

1188

S=2207 I=74 E=0

XFF4834R

XFF4834R_plc00480 lcl|XFF4834R_plc00390763_0041950_f1_XFF4834R-XFF4834R_plc00480

607

1257

S=2172 I=73 E=0

XFF4834R

XFF4834R_plc00480 lcl|XFF4834R_plc00390763_0041950_f1_XFF4834R-XFF4834R_plc00480

641

1276

S=2144 I=73 E=0

XFF4834R

XFF4834R_plc00480 lcl|XFF4834R_plc00390763_0041950_f1_XFF4834R-XFF4834R_plc00480

675

1315

S=2012 I=70 E=0

XFF4834R

XFF4834R_plc_0001 lcl|XFF4834R_plc_0000001_0000893_f3_XFF4834R-XFF4834R_plc_0001

1260

1554

S=1146 I=80 E=1.26315e-131

XFF4834R

XFF4834R_plc_0001 lcl|XFF4834R_plc_0000001_0000893_f3_XFF4834R-XFF4834R_plc_0001

716

771

S=104 I=53 E=2.11155e-05

X.species

NP_644793.1 lcl|pthA4-XACb0065

573

1554

S=3794 I=80 E=0

avirulence protein

X.species

NP_644793.1 lcl|pthA4-XACb0065

1

839

S=3368 I=83 E=0

avirulence protein

X.species

NP_644793.1 lcl|pthA4-XACb0065

301

1043

S=2664 I=77 E=0

avirulence protein

X.species

NP_644793.1 lcl|pthA4-XACb0065

202

907

S=2648 I=80 E=0

avirulence protein

X.species

NP_644793.1 lcl|pthA4-XACb0065

369

1111

S=2604 I=76 E=0

avirulence protein

X.species

NP_644708.1 lcl|pthA1-XACa0022

607

1554

S=3607 I=80 E=0

avirulence protein

X.species

NP_644708.1 lcl|pthA1-XACa0022

1

805

S=3200 I=83 E=0

avirulence protein

X.species

NP_644743.1 lcl|pthA3-XACb0015

641

1554

S=3434 I=78 E=0

avirulence protein

X.species

NP_644743.1 lcl|pthA3-XACb0015

1

771

S=3078 I=82 E=0

avirulence protein

X.species

NP_644743.1 lcl|pthA3-XACb0015

301

975

S=2404 I=77 E=0

avirulence protein

pubmed

267

1554

S=4993 I=79 E=0

R26.5

Pubmed 15973413

 

prodomImg

pubmed

1

1145

S=4552 I=82 E=0

R26.5

Pubmed 15973413

 

prodomImg

pubmed

233

1276

S=3835 I=78 E=0

R26.5

Pubmed 15973413

 

prodomImg

pubmed

301

1554

S=4852 I=79 E=0

Avirulence protein

Pubmed 11095723

 

prodomImg

pubmed

1

1111

S=4460 I=83 E=0

Avirulence protein

Pubmed 11095723

 

prodomImg

sp

573

1554

S=3777 I=79 E=0

Avirulence protein AvrBs3 ; Hypersensitive response elicitation Plasmid Secreted Transcription regulation

 

prodomImg

sp

1

839

S=3346 I=82 E=0

Avirulence protein AvrBs3 ; Hypersensitive response elicitation Plasmid Secreted Transcription regulation

 

prodomImg

sp

403

1145

S=2616 I=76 E=0

Avirulence protein AvrBs3 ; Hypersensitive response elicitation Plasmid Secreted Transcription regulation

 

prodomImg

sp

236

941

S=2607 I=79 E=0

Avirulence protein AvrBs3 ; Hypersensitive response elicitation Plasmid Secreted Transcription regulation

 

prodomImg

sp

267

1009

S=2570 I=75 E=0

Avirulence protein AvrBs3 ; Hypersensitive response elicitation Plasmid Secreted Transcription regulation

 

prodomImg

Iprscan IPR005042 [PF03377]

551

756

Avirulence protein PthA-related, Xanthomonas species

Iprscan IPR005042 [PF03377]

989

1197

Avirulence protein PthA-related, Xanthomonas species

Iprscan [seg]

29

54

-

Iprscan [seg]

1452

1463

-

PD011938

1304

1553

S=1026 I=78 E=1.49229e-116

PD011939

70

145

S=356 I=92 E=1.76486e-35

PD044127

1099

1152

S=242 I=93 E=1.23076e-21

PD044127

725

778

S=241 I=93 E=1.7142e-21

PD044127

1133

1186

S=240 I=91 E=2.13169e-21

PD044127

1201

1254

S=238 I=91 E=3.50392e-21

PD044127

487

540

S=238 I=91 E=4.2448e-21

PD044127

759

812

S=237 I=89 E=4.79588e-21

PD044127

351

404

S=236 I=89 E=6.79717e-21

PD044127

963

1016

S=236 I=89 E=6.79717e-21

Iprscan IPR016039 [SSF53901]

1168

1269

Thiolase-like

Iprscan IPR016039 [SSF53901]

624

725

Thiolase-like

Iprscan IPR016039 [SSF53901]

420

521

Thiolase-like

Iprscan IPR016039 [SSF53901]

1066

1167

Thiolase-like

Iprscan IPR016039 [SSF53901]

284

395

Thiolase-like

Iprscan IPR016039 [SSF53901]

531

670

Thiolase-like

Iprscan IPR016039 [SSF53901]

964

1065

Thiolase-like

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one sJ3XgYxU)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

408 hits
swiss-prot

Swiss-Prot ncbi-blastp

5 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

11 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

11 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB8K4EKJ/XFF4834R_pla00510.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB8K4EKJ/XFF4834R_pla00510.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB8K4EKJ/XFF4834R_pla00510.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB8K4EKJ/XFF4834R_pla00510.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.