Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_pla00140xopJ2XFF4834R_pla00140C55-family cysteine protease, Xanthomonas outer protein J2, Type III effector XopJ2 (syn. AvrBsT)

xopJ2 XFF4834R_pla00140

Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL
ID xopJ2
AC XFF4834R_pla00140
LT XFF4834R_pla00140
OR XFF4834R_pla from 9203 to 10255 on strand +
DE C55-family cysteine protease, Xanthomonas outer protein J2, Type III effector XopJ2 (syn. AvrBsT)
IP Serine/Threonine acetyltransferase, YopJ
CL 5.13 Virulence associated GO:0009405
EC
GO InterPro


Curated
PM
AN avirulence protein AvrBsT, detection en ACUR et low GC sur plasmide 1
CC COG: []
CC MODEL:
CC STATUS: curated by boureau (20111123)
MW 39314.6 Da
SQ 350 aa
 
........10........20........30........40........50
| | | | |
MKNFMRSLGFGSSRSSRSSSSNWNEQQTDNDEQAPASSPSTSPSQTSSAF
SGLPERPRKKAIALEESLNSSNNIPYEMRMYAEAALSAAKHGSSEAITKA
DVENKYYLAHAYNERFPELHLSCHDSAQSFFSEFMTSGKQAWRSIVRLSP
SSLHHAAIDVRFKDGKRTMLVIEPALAYGMEGGEIKVMDGYETLGKNVQN
CLGENGDMAVIQLGAQKSRFDCVIFSLNMALCAYQKDSVFDDLHDCLRRN
VRCFSSGERKSILHENIEFIEGDKFLPPIFYKHSHSRGVVGEFISNQPEY
AHKNVSTGRTNPNEDLSERVENFRVRRGDLSYSMSIEASRLRKIRKTIES
X.species

YP_363887.1 xopJ-XCV2156

51

350

S=438 I=37 E=6.23057e-46

outer protein J

X.species

YP_362202.1 avrRxv-XCV0471

50

350

S=437 I=38 E=8.5279e-46

avirulence protein AvrRxv

pubmed

53

350

S=580 I=45 E=1.37771e-61

AvrPpiG1 protein Type III effector HopZ2

Pubmed 11320120

 

prodomImg

pubmed

51

350

S=438 I=37 E=2.61203e-44

Outer protein J

Pubmed 11580833

 

prodomImg

pubmed

50

350

S=437 I=38 E=3.57514e-44

Avirulence protein AvrRxv

Pubmed 8274773

 

prodomImg

pubmed

50

350

S=437 I=38 E=3.70202e-44

Avirulence protein

Pubmed 20208024

 

prodomImg

pubmed

50

348

S=358 I=38 E=1.11189e-34

Avirulence protein AvrXv4

Pubmed 11106027

 

prodomImg

sp

50

350

S=437 I=38 E=2.4342e-44

Avirulence protein AvrRxv

 

prodomImg

sp

95

247

S=228 I=37 E=4.87286e-19

Uncharacterized protein y4lO ; Plasmid

 

prodomImg

sp

98

341

S=152 I=22 E=7.94969e-10

Effector protein yopJ ; Acyltransferase Plasmid Secreted Virulence

 

prodomImg

Iprscan IPR005083 [PF03421]

76

250

Serine/Threonine acetyltransferase, YopJ

Iprscan [seg]

12

21

-

Iprscan [seg]

33

49

-

PD011494

51

248

S=293 I=38 E=5.69491e-28

PD122726

266

348

S=233 I=60 E=8.09459e-21

PD264003

22

71

S=151 I=64 E=8.99069e-11

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one fwQCyw8W)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

25 hits
swiss-prot

Swiss-Prot ncbi-blastp

3 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

3 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBAmEsad/XFF4834R_pla00140.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBAmEsad/XFF4834R_pla00140.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBAmEsad/XFF4834R_pla00140.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBAmEsad/XFF4834R_pla00140.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.