Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr42980rpmHXFF4834R_chr42980probable 50S ribosomal protein L34

rpmH XFF4834R_chr42980
XFF4834R_chr42970
XFF4834R_chr42970
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr00010
XFF4834R_chr00010
ID rpmH
AC XFF4834R_chr42980
LT XFF4834R_chr42980
OR XFF4834R_chr from 4981613 to 4981753 on strand -
DE probable 50S ribosomal protein L34
IP Ribosomal protein L34
CL 2.3.8 Ribosomal proteins GO:0003735
EC
GO InterPro
Biological Process: translation (GO:0006412)
Cellular Component: ribosome (GO:0005840)
Cellular Component: intracellular (GO:0005622)
Molecular Function: structural constituent of ribosome (GO:0003735)

Curated
PM
AN
CC COG: [J] Translation, ribosomal structure and biogenesis;
CC MODEL: XFF4834R
CC STATUS: curated by fguerin (20100422)
MW 5310.2 Da
SQ 46 aa
 
........10........20........30........40........50
| | | | |
MATKRTFQPSNLKRARDHGFRARMATADGRKILARRRAKGRKRLSA
X.species

YP_366218.1 lcl|rpmH-XCV4487

1

28

S=142 I=100 E=3.1214e-11

50S ribosomal protein L34

X.species

NP_639576.1 lcl|rpmH-XCC4242

1

28

S=142 I=100 E=3.1214e-11

50S ribosomal protein L34

X.species

NP_644668.1 lcl|rpmH-XAC4374

1

28

S=142 I=100 E=3.1214e-11

50S ribosomal protein L34

X.species

lcl|rpmH-XALc_3173

1

28

S=138 I=96 E=1.10508e-10

probable 50s ribosomal protein l34

pubmed

1

28

S=142 I=100 E=1.44225e-09

50S ribosomal protein L34 ; Ribonucleoprotein

Pubmed 12039751

 

prodomImg

pubmed

4

28

S=106 I=84 E=3.78347e-05

50S ribosomal protein L34 ; Ribonucleoprotein

Pubmed 2106132

 

prodomImg

pubmed

4

28

S=105 I=80 E=5.31575e-05

50S ribosomal protein L34 ; Ribonucleoprotein

Pubmed 1552862,2106132

 

prodomImg

sp

1

28

S=142 I=100 E=9.26945e-10

50S ribosomal protein L34 ; Ribonucleoprotein

 

prodomImg

sp

1

28

S=142 I=100 E=9.26945e-10

50S ribosomal protein L34 ; Ribonucleoprotein

 

prodomImg

sp

1

28

S=142 I=100 E=9.26945e-10

50S ribosomal protein L34 ; Ribonucleoprotein

 

prodomImg

sp

1

28

S=142 I=100 E=9.26945e-10

50S ribosomal protein L34 ; Ribonucleoprotein

 

prodomImg

sp

1

28

S=142 I=100 E=9.26945e-10

50S ribosomal protein L34 ; Ribonucleoprotein

 

prodomImg

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one R6VkMw9E)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

3 hits
swiss-prot

Swiss-Prot ncbi-blastp

90 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

0 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB7dnglw/XFF4834R_chr42980.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB7dnglw/XFF4834R_chr42980.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB7dnglw/XFF4834R_chr42980.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB7dnglw/XFF4834R_chr42980.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.