Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr42970rnpAXFF4834R_chr42970putative Ribonuclease P protein component

rnpA XFF4834R_chr42970
XFF4834R_chr42960
XFF4834R_chr42960
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr42980
XFF4834R_chr42980
ID rnpA
AC XFF4834R_chr42970
LT XFF4834R_chr42970
OR XFF4834R_chr from 4981137 to 4981574 on strand -
DE putative Ribonuclease P protein component
IP Ribonuclease P; Ribosomal protein S5 domain 2-type fold
CL 2.2.3 RNA modification GO:0009451
EC
GO InterPro
Biological Process: tRNA processing (GO:0008033)
Molecular Function: tRNA binding (GO:0000049)
Molecular Function: ribonuclease P activity (GO:0004526)

Curated
PM
AN
CC COG: [J] Translation, ribosomal structure and biogenesis;
CC MODEL: XFF4834R
CC STATUS: curated by fguerin (20100422)
MW 16027.4 Da
SQ 145 aa
 
........10........20........30........40........50
| | | | |
MNASNPCRRFPRSARVRTRAQYTIVFDTARRTSDPLLSLHWRTGDTPPRL
GMAVSRKVDTRAVGRNRIKRVLRDAMRHLLPELAGGDYVIVARSAAAKAT
NPQIRDAFVRLLRRAGALPLPAAPGTMPPARTVRPSSPSPTEPEL
X.species

YP_366217.1 lcl|rnpA-XCV4486

1

145

S=637 I=89 E=1.3668e-70

ribonuclease P

X.species

NP_644667.1 lcl|rnpA-XAC4373

1

145

S=624 I=87 E=5.27533e-69

ribonuclease P

X.species

NP_639575.1 lcl|rnpA-XCC4241

1

144

S=598 I=84 E=5.89368e-66

ribonuclease P

X.species

lcl|rnpA-XALc_3172

18

129

S=328 I=61 E=3.54944e-33

probable ribonuclease p protein

pubmed

1

144

S=591 I=83 E=1.49161e-63

Ribonuclease P ; Endonuclease Hydrolase RNA-binding tRNA processing

Pubmed 12039751

 

prodomImg

pubmed

10

108

S=155 I=39 E=1.07961e-10

Ribonuclease P protein component EC=3.1.26.5 ; Endonuclease Hydrolase RNA-binding tRNA processing

Pubmed 1552862

 

prodomImg

pubmed

10

108

S=147 I=36 E=9.22032e-10

Ribonuclease P protein component EC=3.1.26.5 ; Endonuclease Hydrolase RNA-binding tRNA processing

Pubmed 2415431,7686882

 

prodomImg

pubmed

10

108

S=141 I=32 E=4.35255e-09

Ribonuclease P protein component EC=3.1.26.5 ; Endonuclease Hydrolase RNA-binding tRNA processing

Pubmed 2172087

 

prodomImg

sp

1

145

S=637 I=89 E=3.02163e-69

Ribonuclease P protein component EC=3.1.26.5 ; Endonuclease Hydrolase RNA-binding tRNA processing

 

prodomImg

sp

1

145

S=624 I=87 E=1.16624e-67

Ribonuclease P protein component EC=3.1.26.5 ; Endonuclease Hydrolase RNA-binding tRNA processing

 

prodomImg

sp

1

145

S=606 I=84 E=1.42282e-65

Ribonuclease P protein component EC=3.1.26.5 ; Endonuclease Hydrolase RNA-binding tRNA processing

 

prodomImg

sp

1

144

S=598 I=84 E=1.30294e-64

Ribonuclease P protein component EC=3.1.26.5 ; Endonuclease Hydrolase RNA-binding tRNA processing

 

prodomImg

sp

1

144

S=598 I=84 E=1.30294e-64

Ribonuclease P protein component EC=3.1.26.5 ; Endonuclease Hydrolase RNA-binding tRNA processing

 

prodomImg

PD612855

1

61

S=313 I=98 E=1.78448e-30

PD592110

50

106

S=140 I=53 E=1.75346e-09

PD003629

48

103

S=136 I=49 E=5.4468e-09

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one BU8qrzgi)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

4 hits
swiss-prot

Swiss-Prot ncbi-blastp

141 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

0 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBROWJP2/XFF4834R_chr42970.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBROWJP2/XFF4834R_chr42970.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBROWJP2/XFF4834R_chr42970.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBROWJP2/XFF4834R_chr42970.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.