Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr42960yidCXFF4834R_chr42960putative inner membrane protein translocase component YidC

yidC XFF4834R_chr42960
XFF4834R_chr_4573
XFF4834R_chr_4573
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr42970
XFF4834R_chr42970
ID yidC
AC XFF4834R_chr42960
LT XFF4834R_chr42960
OR XFF4834R_chr from 4979387 to 4981111 on strand -
DE putative inner membrane protein translocase component YidC
IP Membrane insertion protein, OxaA/YidC; Membrane insertion protein, OxoA/YidC, N-terminal; Membrane insertion protein, OxaA/YidC, core
CL 4 Transport GO:0005215 GO:0006810
EC
GO InterPro
Biological Process: protein insertion into membrane (GO:0051205)
Cellular Component: integral to membrane (GO:0016021)

Curated
PM
AN
CC COG: [U] Intracellular trafficking, secretion, and vesicular transport;
CC MODEL: XFF4834R
CC STATUS: curated by jacques (20111025)
MW 63303.9 Da
SQ 574 aa
 
........10........20........30........40........50
| | | | |
MNQTRVFLIFAWLMVAALLWMEWGKDKAAANAPVAAATQSVPAARDLDAA
APSAANVPAAQSIPQAGAPGTVPATSSTAATPAAAGAAPVVTVTSDVLRL
KLDGRSVLDAELLQFPQTKDGTAPVSLLTEDPAHPYNATSGWASERSPVP
GVAGFRAEQPGTTFEMAKGQNTLVVPFVWNGPDGVSIRRTFTLERGRYAI
SIKDEVINKSGAPWNGYVFRKLSRVPTILSRGMTNPDSFSFNGATWYSPQ
EGYERRAFKDYMDDGGLNRQITGGWVALLQHHFFTAWIPQKDQASLYVLA
QDGPRDVAELRGPAFTVAPGQTASTEARLWVGPKLVSLIAKEDVKGLDRV
VDYSRFSIMAIIGQGLFWVLSHLHSFLHNWGWAIIGLVVLLRLALYPLSA
AQYKSGAKMRRFQPRLAQLKERYGDDRVKYQQATMELFKKEKINPMGGCL
PLLIQMPIFFALYWVLVESVELRQAPWLGWIQDLTARDPYFILPLLNISI
MWATQKLTPTPGMDPMQAKMMQFMPLVFGVMMAFMPAGLVLYWVVNGGLG
LLIQWWMIRQHGEKPSKIIQANAK
Hamap OXAA_MF_01810 raw_score=4477 norm_score=17.838

Membrane protein oxaA [oxaA].

X.species

NP_644666.1 lcl|XAC4372-XAC4372

1

574

S=2570 I=86 E=0

putative inner membrane protein translocase component YidC

X.species

YP_366216.1 lcl|yidC-XCV4485

1

574

S=2545 I=86 E=0

putative inner membrane protein translocase component YidC

X.species

NP_639574.1 lcl|XCC4240

1

574

S=2498 I=84 E=0

putative inner membrane protein translocase component YidC

X.species

lcl|oxaA-XALc_3171

1

568

S=1922 I=63 E=0

probable inner-membrane protein oxaa

pubmed

1

574

S=2498 I=84 E=0

Inner membrane protein oxaA ; Cell Transmembrane

Pubmed 12039751

 

prodomImg

pubmed

96

560

S=904 I=41 E=1.34858e-100

Inner membrane protein oxaA ; Cell Transmembrane

Pubmed 1552862

 

prodomImg

pubmed

96

564

S=810 I=40 E=3.22348e-89

Inner membrane protein oxaA ; Cell Transmembrane

Pubmed 7686882

 

prodomImg

pubmed

96

561

S=810 I=37 E=3.67386e-89

Inner membrane protein oxaA ; Cell Transmembrane

Pubmed 8071197

 

prodomImg

pubmed

96

558

S=650 I=31 E=8.20661e-70

Membrane protein oxaA ; Cell Transmembrane

Pubmed 9516544

 

prodomImg

pubmed

175

557

S=476 I=30 E=9.27111e-49

Inner membrane protein oxaA ; Cell Transmembrane

Pubmed 17916642

 

prodomImg

pubmed

326

554

S=451 I=38 E=1.03578e-45

Membrane protein oxaA ; Cell Transmembrane

Pubmed 9420234

 

prodomImg

pubmed

364

561

S=305 I=33 E=5.89102e-28

Inner membrane protein oxaA ; Cell Transmembrane

Pubmed 9666070

 

prodomImg

pubmed

402

559

S=254 I=37 E=8.16397e-22

Membrane protein oxaA 1 ; Cell Lipoprotein Palmitate Signal Sporulation Transmembrane

Pubmed 1487728,1552862

 

prodomImg

pubmed

369

561

S=240 I=28 E=3.91841e-20

Inner membrane protein oxaA ; Cell Transmembrane

Pubmed 15547252

 

prodomImg

sp

1

574

S=2570 I=86 E=0

Inner membrane protein oxaA ; Cell Transmembrane

 

prodomImg

sp

1

574

S=2545 I=86 E=0

Inner membrane protein oxaA ; Cell Transmembrane

 

prodomImg

sp

1

574

S=2498 I=84 E=0

Inner membrane protein oxaA ; Cell Transmembrane

 

prodomImg

sp

1

574

S=2495 I=84 E=0

Inner membrane protein oxaA ; Cell Transmembrane

 

prodomImg

sp

1

574

S=2472 I=82 E=0

Inner membrane protein oxaA ; Cell Transmembrane

 

prodomImg

Iprscan [MF_01810]

4

555

-

Iprscan IPR001708 [PF02096]

378

562

Membrane insertion protein, OxaA/YidC

Iprscan IPR019998 [TIGR03593]

3

378

Membrane insertion protein, OxoA/YidC, N-terminal

Iprscan IPR020001 [TIGR03592]

379

559

Membrane insertion protein, OxaA/YidC, core

Iprscan [seg]

28

37

-

Iprscan [seg]

40

60

-

Iprscan [seg]

68

95

-

Iprscan [seg]

387

401

-

Iprscan [tmhmm]

7

24

-

Iprscan [tmhmm]

379

401

-

Iprscan [tmhmm]

445

467

-

Iprscan [tmhmm]

523

545

-

PD013985

96

380

S=326 I=33 E=5.98651e-32

PD002157

451

515

S=214 I=69 E=2.38946e-18

PD986028

451

546

S=135 I=34 E=8.03797e-09

PD745144

402

453

S=135 I=47 E=8.39612e-09

PD271306

1

27

S=116 I=78 E=1.61191e-06

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one T0cyQs7T)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

32 hits
swiss-prot

Swiss-Prot ncbi-blastp

327 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

1 hits
Interpro Scan

IprScan

12 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBGTCKqG/XFF4834R_chr42960.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBGTCKqG/XFF4834R_chr42960.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBGTCKqG/XFF4834R_chr42960.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBGTCKqG/XFF4834R_chr42960.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.