Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr42940trmEXFF4834R_chr42940probable tRNA modification GTPase TrmE

trmE XFF4834R_chr42940
XFF4834R_chr42940
XFF4834R_chr42940
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr_4572
XFF4834R_chr_4572
ID trmE
AC XFF4834R_chr42940
LT XFF4834R_chr42940
OR XFF4834R_chr from 4976469 to 4977809 on strand -
DE probable tRNA modification GTPase TrmE
IP tRNA modification GTPase TrmE; GTP-binding, MJ1339, predicted; GTP-binding protein TrmE, N-terminal
CL 2.2.3 RNA modification GO:0009451
EC
GO InterPro
Biological Process: tRNA modification (GO:0006400)
Cellular Component: intracellular (GO:0005622)
Molecular Function: GTP binding (GO:0005525)
Molecular Function: GTPase activity (GO:0003924)

Curated
PM
AN
CC COG: [R] General function prediction only;
CC MODEL: XFF4834R
CC STATUS: curated by pieretti (20100930)
MW 47268.8 Da
SQ 446 aa
 
........10........20........30........40........50
| | | | |
MSSSTSTIVAIASAAGIGGVGIVRLSGPQSVQIAAHLGIARMRPRHAHYA
RFRDGQGAVIDDGIALWFNAPHSFTGEDVVELQGHGSPVLLRQLVARCIA
LGARQARAGEFSERAFLNGKLDLAQAEAIADLIAAGDLRAARAARRALDG
VFSQRVDALAETLTRLRIHVEAAIDFADEPLDTLGGNQVRDGLGQARNVL
AQLLRDAERGRKLRDGLHAVLIGPPNAGKSSLLNALAGSDRAIVTDVAGT
TRDTLHEAIQLDGFELTLVDTAGLRDGGDAIEREGMRRARVELERADLAL
VVLDARDPQAARDAIGDAIDAVPRQLWIHNKCDLLGNAASLDANAIAVSA
VTGQGLEQLHIRLRALALGDGVDSVDGEFSARTRHVEALRRAEQHADAAD
LELGFEQLELAAEELRLAHEALGEITGKLSADDLLGKIFSSFCIGK
Hamap MNME_MF_00379 raw_score=8072 norm_score=31.303

tRNA modification GTPase mnmE [mnmE].

XFF4834R

XFF4834R_chr21240 lcl|der-XFF4834R_chr21240

221

307

S=158 I=39 E=1.98166e-12

predicted GTP-binding protein

XFF4834R

XFF4834R_chr21240 lcl|der-XFF4834R_chr21240

221

307

S=108 I=38 E=2.26693e-06

predicted GTP-binding protein

XFF4834R

XFF4834R_chr31750 lcl|era-XFF4834R_chr31750

214

305

S=130 I=44 E=4.60503e-09

membrane-associated, 16S rRNA-binding GTPase

XFF4834R

XFF4834R_chr27750 lcl|hflX-XFF4834R_chr27750

195

308

S=95 I=36 E=7.22238e-05

predicted GTPase

X.species

NP_644664.2 lcl|trmE-XAC4370

24

446

S=1721 I=83 E=0

tRNA modification GTPase TrmE

X.species

YP_366214.1 lcl|trmE-XCV4483

24

446

S=1695 I=82 E=0

tRNA modification GTPase TrmE

X.species

NP_639572.1 lcl|trmE-XCC4238

24

446

S=1553 I=75 E=0

tRNA modification GTPase TrmE

X.species

lcl|XALc_3170

24

446

S=1215 I=62 E=6.06574e-140

putative trna modification gtpase protein

X.species

NP_637352.1 lcl|engA-XCC1987

221

307

S=158 I=39 E=7.14237e-12

GTP-binding protein EngA

X.species

NP_637352.1 lcl|engA-XCC1987

221

307

S=108 I=38 E=8.38707e-06

GTP-binding protein EngA

X.species

NP_642347.1 lcl|engA-XAC2021

221

307

S=158 I=39 E=7.20492e-12

GTP-binding protein EngA

X.species

NP_642347.1 lcl|engA-XAC2021

221

307

S=108 I=38 E=8.5346e-06

GTP-binding protein EngA

X.species

YP_363803.1 lcl|engA-XCV2072

221

307

S=158 I=39 E=7.33166e-12

GTP-binding protein EngA

X.species

YP_363803.1 lcl|engA-XCV2072

221

307

S=108 I=38 E=8.60933e-06

GTP-binding protein EngA

pubmed

24

243

S=827 I=76 E=1.99533e-91

GTP-binding protein ; Nucleotide-binding tRNA processing

Pubmed 12039751

 

prodomImg

pubmed

24

446

S=737 I=43 E=1.97709e-80

tRNA modification GTPase mnmE EC=3.6.-.- ; Cytoplasm GTP-binding Hydrolase Magnesium Metal-binding Nucleotide-binding Potassium processing

Pubmed 1552862

 

prodomImg

pubmed

24

446

S=717 I=41 E=4.14146e-78

tRNA modification GTPase mnmE EC=3.6.-.- ; Cytoplasm GTP-binding Hydrolase Magnesium Metal-binding Nucleotide-binding Potassium processing

Pubmed 1917835,7686882

 

prodomImg

pubmed

24

446

S=624 I=36 E=9.39468e-67

tRNA modification GTPase mnmE EC=3.6.-.- ; Cytoplasm GTP-binding Hydrolase Magnesium Metal-binding Nucleotide-binding Potassium processing

Pubmed 9420234

 

prodomImg

pubmed

24

446

S=580 I=33 E=1.78349e-61

tRNA modification GTPase mnmE EC=3.6.-.- ; Cytoplasm GTP-binding Hydrolase Magnesium Metal-binding Nucleotide-binding Potassium processing

Pubmed 9516544

 

prodomImg

pubmed

33

446

S=513 I=28 E=2.69228e-53

tRNA modification GTPase mnmE EC=3.6.-.- ; Cytoplasm GTP-binding Hydrolase Magnesium Metal-binding Nucleotide-binding Potassium processing

Pubmed 17038625

 

prodomImg

pubmed

59

446

S=488 I=36 E=2.39777e-50

tRNA modification GTPase mnmE EC=3.6.-.- ; Cytoplasm GTP-binding Hydrolase Magnesium Metal-binding Nucleotide-binding Potassium processing

Pubmed 18441057

 

prodomImg

pubmed

24

446

S=482 I=32 E=1.47028e-49

tRNA modification GTPase mnmE EC=3.6.5.- ; Cytoplasm GTP-binding Hydrolase Magnesium Metal-binding Nucleotide-binding Potassium processing

Pubmed 11092873

 

prodomImg

pubmed

45

446

S=480 I=31 E=2.68331e-49

tRNA modification GTPase mnmE EC=3.6.-.- ; Cytoplasm GTP-binding Hydrolase Magnesium Metal-binding Nucleotide-binding Potassium processing

Pubmed 18263572

 

prodomImg

pubmed

24

446

S=478 I=31 E=3.86993e-49

tRNA modification GTPase mnmE EC=3.6.-.- ; Cytoplasm GTP-binding Hydrolase Magnesium Metal-binding Nucleotide-binding Potassium processing

Pubmed 10427704

 

prodomImg

Iprscan [coil]

398

419

-

Iprscan IPR018948 [G3DSA:3.30.1360.120]

6

120

GTP-binding protein TrmE, N-terminal

Iprscan [G3DSA:3.40.50.300]

210

367

-

Iprscan IPR004520 [MF_00379]

6

446

tRNA modification GTPase TrmE

Iprscan IPR018948 [PF10396]

7

120

GTP-binding protein TrmE, N-terminal

Iprscan IPR002917 [PF01926]

217

333

GTP-binding protein, HSR1-related

Iprscan IPR004520 [TIGR00450]

10

446

tRNA modification GTPase TrmE

Iprscan IPR005225 [TIGR00231]

214

365

Small GTP-binding protein

Iprscan [seg]

2

23

-

Iprscan [seg]

121

149

-

Iprscan [seg]

310

321

-

Iprscan [seg]

401

424

-

PDA1F4H7

306

383

S=293 I=74 E=6.34025e-28

PDA24634

151

194

S=208 I=93 E=1.14749e-17

PD585276

26

86

S=148 I=50 E=2.046e-10

PD004624

89

179

S=142 I=38 E=1.05383e-09

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 4Afpx2Ci)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

155 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

4 hits
hamap

HAMAP scan

1 hits
Interpro Scan

IprScan

12 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBY2viGN/XFF4834R_chr42940.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBY2viGN/XFF4834R_chr42940.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBY2viGN/XFF4834R_chr42940.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBY2viGN/XFF4834R_chr42940.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.