Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr42650xopAFXFF4834R_chr42650Xanthomonas outer protein AF, type III effector XopAF

xopAF XFF4834R_chr42650
XFF4834R_chr42650
XFF4834R_chr42650
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr_4541
XFF4834R_chr_4541
ID xopAF
AC XFF4834R_chr42650
LT XFF4834R_chr42650
OR XFF4834R_chr from 4946786 to 4947628 on strand +
DE Xanthomonas outer protein AF, type III effector XopAF
IP
CL 5.13 Virulence associated GO:0009405
EC
GO InterPro


Curated
PM
AN orthologue de Hop AF1, AvrXv3. boureau: Le start est modifie pour matcher la longueur de HopAF1 chez Pseudo. L'ORF predite est donc rallongee en N-ter. Mais l usage du code est mauvais dans la partie rajoutee.
CC COG: [S] Function unknown;
CC MODEL: XFF4834R
CC STATUS: curated by boureau (20121114)
MW 30064.3 Da
SQ 280 aa
 
........10........20........30........40........50
| | | | |
MGLCITKPTGSQYGGDSGSPPSSPNVTASSSHQPTASNAGTFDGLNGRPP
KLSHHRLARRAGQYTLKQTSIADYQSERGHPGNSIKDRSGSLIPWVRVSD
VDADSNYSFEIDSSTTVKVAGFNGLTPNHQGTRHLYSAGTSQVNMPVVTD
NMTACIAVACAAERIDHYTGERMPGAQVRVFHLLPFNHQELMPENVIASI
RDYIHDVKAKGLTMRVAMYGGDRVGDFSVSTAEALGCLFENEGIPVEFNE
TCANRNSEALLGAVILNDNSTQFIKHLVAA
Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one dP3t8Zr1)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

1 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

0 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBPmE0sI/XFF4834R_chr42650.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBPmE0sI/XFF4834R_chr42650.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBPmE0sI/XFF4834R_chr42650.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBPmE0sI/XFF4834R_chr42650.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.