Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr42230XFF4834R_chr_4911210_4911374_f3_acur-XFF4834R_chr42230XFF4834R_chr42230hypothetical secreted protein

XFF4834R_chr_4911210_4911374_f3_acur-XFF4834R_chr42230 XFF4834R_chr42230
XFF4834R_chr42220
XFF4834R_chr42220
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr42240
XFF4834R_chr42240
ID XFF4834R_chr_4911210_4911374_f3_acur-XFF4834R_chr42230
AC XFF4834R_chr42230
LT XFF4834R_chr42230
OR XFF4834R_chr from 4911165 to 4911374 on strand +
DE hypothetical secreted protein
IP
CL 7.5 Extracellular GO:0005576
EC
GO InterPro


Curated
PM
AN changement de start prendre celui donne par acur increased +15 aa car secreted avec ce start et partiel similarity avec Xoo
CC COG: []
CC MODEL: acur
CC STATUS: curated by darrasse (20121116)
MW 7641.2 Da
SQ 69 aa
 
........10........20........30........40........50
| | | | |
MQDSYSDEVAMDRHVLWPVRQDAAADNATCSADRCNSARQNDDSARANLQ
VNTARLGNGRLRPYCGVRS
Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one k0r3kVq8)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

0 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

0 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB4dfPuV/XFF4834R_chr42230.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB4dfPuV/XFF4834R_chr42230.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB4dfPuV/XFF4834R_chr42230.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB4dfPuV/XFF4834R_chr42230.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.