Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr41640XFF4834R_chr_4843538_4845694_r3_XFF4834R-XFF4834R_chr41640XFF4834R_chr41640putative lytic murein transglycosylase

XFF4834R_chr_4843538_4845694_r3_XFF4834R-XFF4834R_chr41640 XFF4834R_chr41640
XFF4834R_chr41630
XFF4834R_chr41630
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr41650
XFF4834R_chr41650
ID XFF4834R_chr_4843538_4845694_r3_XFF4834R-XFF4834R_chr41640
AC XFF4834R_chr41640
LT XFF4834R_chr41640
OR XFF4834R_chr from 4843538 to 4845694 on strand -
DE putative lytic murein transglycosylase
IP Peptidoglycan binding-like; Aldose 1-epimerase; Glycoside hydrolase-type carbohydrate-binding; Lytic murein transglycosylase
CL 1.7.34 Peptidoglycan (murein) turnover, recycling GO:0000270
EC
GO InterPro
Biological Process: carbohydrate metabolic process (GO:0005975)
Biological Process: metabolic process (GO:0008152)
Molecular Function: carbohydrate binding (GO:0030246)
Molecular Function: isomerase activity (GO:0016853)
Molecular Function: catalytic activity (GO:0003824)

Curated
PM
AN his family consists of lytic murein transglycosylases (murein hydrolases) related to MltB (P41052), which is a 38 kDa membrane-bound lipoprotein in Escherichia coli. The N-terminal region of this protein contains a lipoprotein-processing site which is conserved in about half the members of this family. Proteolytic cleavage of MltB produces a fully-active, soluble form of this enzyme known as Slt35 (for soluble lytic transglycosylase). This enzyme catalyzes the cleavage of the glycosidic bonds between N-acetylmuramic acid and N-acetylglucosamine residues in peptidoglycan. Its physiological role is unknown as deletion of the gene shows no obvious phenotype [1], though it has been suggested to play a role in recycling of muropeptides during cell elongation and/or cell division.
CC COG: [M] Cell wall/membrane/envelope biogenesis;
CC MODEL: XFF4834R
CC STATUS: curated by irobene (20100823)
MW 76865.3 Da
SQ 718 aa
 
........10........20........30........40........50
| | | | |
MTLPRRALPFVLGLLPLVACADPAFDRCLTGLQTQAAAKGVDAASFQRFT
AGLAPDPSVLPLLDAQPEFTTPIWDYLASLVDSQRVTDGQAMLVTHRELL
SRLSDQTGVDPATIVAVWGVESDYGRVTGKRPLLVSLATLSCAGRRQPFF
RGEFLALLSLLQQGDLSADGLTGSWAGAFGQTQFMPSTYARIAVDGDGRR
DLVTSISDALASTANYLVKAGWERARPWGVEVTLPRGFDASKAGRTGRQP
LQAWQSAGLLGTDGKPLAPTGLPAETPAALLLPAGATGPALLVFRNYDAI
YAYNAAESYALSIALLADRLRGGPGLIAAWPTDDPGLGRPERRELQQLLL
ARGYQIGEADGMVGSATRRAIQVEQTRLGLQPADGRPGQRILAALRAAPP
VAGAAAMRATAFKLPAAYPAFAQSPSVQKASPMSDTTGLTTGDFHGFPSL
LIDTPFSTAAISLFGGQLLSFVPKGGQDVMWLSPSAQQPPTPIRGGAPVC
WPYFGRQDQTGDVPAHGFVRTVAWQLTESRREDDGTVVLTLTPPRFDDLA
LRLRMTLRIGRTLEQRLITDNTSAAPVRFTQALHNYFRVGDALKVSVQGL
DGLDYLDKYENYATAHRQQGDWSLRDPRDPGRSDRIYTNAGGRYTLTDPV
LGRRIVIATEGSRSLVAWNPGEEAGKQMADVGEGWRNYVCLEAANAGPDV
IELAPGASHTLTQTISVE
XFF4834R

XFF4834R_plc00360 lcl|XFF4834R_plc_0030113_0031384_r1_XFF4834R-XFF4834R_plc00360

24

385

S=537 I=36 E=3.74825e-58

XFF4834R

XFF4834R_chr06710 lcl|mltB-XFF4834R_chr06710

36

234

S=260 I=35 E=1.4713e-24

membrane-bound lytic murein transglycosylase B

X.species

NP_644590.2 lcl|XAC4296-XAC4296

1

718

S=3186 I=87 E=0

epimerase

X.species

YP_366126.1 lcl|XCV4395

1

718

S=3181 I=87 E=0

putative transglycosylase precursor

X.species

NP_639491.1 lcl|XCC4157

17

718

S=2941 I=82 E=0

epimerase

X.species

lcl|XALc_3122

22

446

S=1196 I=59 E=2.04784e-137

putative membrane bound lytic murein transglycosylase b transmembrane protein

X.species

lcl|XALc_3121

433

717

S=1049 I=72 E=1.14458e-119

hypothetical aldose 1-epimerase protein

X.species

lcl|XALc_1923

24

385

S=555 I=36 E=1.00648e-59

probable lytic murein transglycosylase precursor transmembrane protein

X.species

YP_364171.1 lcl|hpaJ-XCV2440

24

385

S=528 I=36 E=1.81636e-56

lytic murein transglycosylase precursor

X.species

NP_643533.1 lcl|mltB-XAC3225

24

385

S=525 I=35 E=4.05097e-56

transglycosylase

X.species

NP_644735.1 lcl|mlt-XACb0007

24

385

S=524 I=35 E=4.45873e-56

lytic murein transglycosylase

X.species

lcl|mltB-XALc_0812

2

322

S=270 I=29 E=3.34482e-25

probable membrane-bound lytic murein transglycosylase protein

X.species

NP_638804.1 lcl|mltB-XCC3458

36

237

S=263 I=36 E=2.37868e-24

membrane-bound lytic transglycosylase

X.species

NP_641015.1 lcl|mltB-XAC0662

36

239

S=262 I=35 E=2.61811e-24

membrane-bound lytic transglycosylase

X.species

YP_362454.1 lcl|mltB-XCV0723

36

239

S=262 I=35 E=2.75872e-24

membrane-bound lytic transglycosylase

pubmed

19

385

S=560 I=36 E=1.00606e-58

Type III effector HopPmaG

Pubmed 11872842

 

prodomImg

pubmed

24

385

S=528 I=36 E=7.92384e-55

Putative murein transglycosylase ; Signal

Pubmed 14645268

 

prodomImg

pubmed

2

385

S=514 I=35 E=3.27924e-53

Translycolase-related protein

Pubmed 18773201

 

prodomImg

pubmed

56

321

S=330 I=32 E=6.6967e-31

Putative transglycosylase

Pubmed 10673051

 

prodomImg

pubmed

56

321

S=327 I=32 E=1.5601e-30

Gene cluster for 6-deoxy-L-talan synthesis, complete cds

Pubmed 9805002

 

prodomImg

sp

425

717

S=350 I=33 E=1.99407e-33

Putative glucose-6-phosphate 1-epimerase EC=5.1.3.15 ; Isomerase

 

prodomImg

sp

457

706

S=285 I=32 E=1.56532e-25

Putative glucose-6-phosphate 1-epimerase EC=5.1.3.15 ; Isomerase

 

prodomImg

sp

76

263

S=233 I=36 E=2.99513e-19

Membrane-bound lytic murein transglycosylase B EC=4.2.2.n1 ; Cell outer wall biogenesis/degradation Lipoprotein Lyase Palmitate Signal

 

prodomImg

sp

457

718

S=198 I=26 E=4.7386e-15

Glucose-6-phosphate 1-epimerase EC=5.1.3.15 ; Isomerase Phosphoprotein

 

prodomImg

Iprscan [G3DSA:1.10.530.10]

68

320

-

Iprscan IPR014718 [G3DSA:2.70.98.10]

427

715

Glycoside hydrolase-type carbohydrate-binding, subgroup

Iprscan [PTHR11122]

443

718

-

Iprscan IPR008183 [PF01263]

453

715

Aldose 1-epimerase

Iprscan IPR002477 [PF01471]

340

395

Peptidoglycan binding-like

Iprscan IPR011970 [TIGR02283]

24

322

Lytic murein transglycosylase

Iprscan [seg]

155

169

-

Iprscan [seg]

266

292

-

Iprscan [seg]

341

350

-

Iprscan [seg]

392

411

-

Iprscan [SignalP-NN(euk)]

1

21

-

PD135920

25

154

S=226 I=40 E=9.6995e-20

PD527256

589

717

S=218 I=39 E=9.03846e-19

PD715966

412

449

S=192 I=97 E=1.4437e-15

PDA2M998

521

550

S=147 I=97 E=4.02228e-10

PD017571

450

520

S=139 I=45 E=3.26012e-09

PD661282

1

27

S=127 I=93 E=1.06619e-07

PD887947

465

520

S=117 I=42 E=1.6474e-06

PDA5G475

1

27

S=114 I=89 E=3.73877e-06

PD901093

433

460

S=109 I=79 E=1.35873e-05

Iprscan [SSF53955]

8

326

-

Iprscan IPR011013 [SSF74650]

436

716

Glycoside hydrolase-type carbohydrate-binding

Iprscan IPR002477 [SSF47090]

324

396

Peptidoglycan binding-like

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one HoAyzGqK)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

15 hits
swiss-prot

Swiss-Prot ncbi-blastp

4 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

2 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

14 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBEJ47fh/XFF4834R_chr41640.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBEJ47fh/XFF4834R_chr41640.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBEJ47fh/XFF4834R_chr41640.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBEJ47fh/XFF4834R_chr41640.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.