Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr41270xynA2XFF4834R_chr41270putative endo-1,4-beta-xylanase

xynA2 XFF4834R_chr41270
XFF4834R_chr41260
XFF4834R_chr41260
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr41280
XFF4834R_chr41280
ID xynA2
AC XFF4834R_chr41270
LT XFF4834R_chr41270
OR XFF4834R_chr from 4793782 to 4794774 on strand -
DE putative endo-1,4-beta-xylanase
IP Glycoside hydrolase, family 10; Glycoside hydrolase, catalytic core
CL 1.2.4 Polysaccharides GO:0000272
EC
GO InterPro
Biological Process: carbohydrate metabolic process (GO:0005975)
Molecular Function: catalytic activity (GO:0003824)
Molecular Function: cation binding (GO:0043169)
hydrolyzing O-glycosyl compounds (GO:0004553)

Curated
PM
AN
CC COG: [G] Carbohydrate transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by elauber (20100719)
MW 36776.5 Da
SQ 330 aa
 
........10........20........30........40........50
| | | | |
MHMRAVTLGLLMVAGMAAPAHAAPLAATASKFLGSAYGAQQAPGFAQYWN
KLTPENGGKLGSVEAVRDQMDWSTLDAAYRFAQANQMPFQMHVMVWGNQQ
PEWIKTLRPAEQRREIEQWFAAVAQRYPDIALLEVVNEPLNDPPSKADTG
GGNYLQALGGNGDSGWEWVLQSFRLARRHFPNTKLMINDYSITNSAQATQ
KYLQIVRLLQRENLVDAIGVQEHAFETTPQVAMSVHRDNLDALAATGLPI
YITEFDLDGPTDAQQLAAYKRVFPVFWEHPAVHGITLWGFRPGLWRDKEA
AYLIRADGTERPALRWLRDYVAAHPGTPAP
XFF4834R

XFF4834R_chr_4406 lcl|XFF4834R_chr_4792311_4792985_r2_XFF4834R-XFF4834R_chr_4406

128

325

S=686 I=64 E=1.46549e-76

XFF4834R

XFF4834R_chr_4407 lcl|XFF4834R_chr_4792895_4793371_r3_XFF4834R-XFF4834R_chr_4407

31

128

S=293 I=58 E=4.9453e-29

XFF4834R

XFF4834R_chr41220 lcl|XFF4834R_chr_4786764_4787996_r2_XFF4834R-XFF4834R_chr41220

35

258

S=231 I=33 E=1.78672e-21

X.species

NP_644553.1 lcl|xynB-XAC4254

1

330

S=1603 I=92 E=0

xylanase

X.species

YP_366091.1 lcl|xynB3-XCV4360

1

330

S=1595 I=92 E=0

xylanase precursor

X.species

NP_639457.1 lcl|xynB-XCC4118

1

330

S=1392 I=80 E=1.24329e-161

xylanase

X.species

lcl|XALc_0036

31

325

S=990 I=63 E=7.922e-113

putative xylanase precursor protein

X.species

YP_366089.1 lcl|xynB2-XCV4358

31

325

S=946 I=60 E=1.54377e-107

xylanase precursor

X.species

NP_644551.1 lcl|xynB-XAC4252

42

325

S=911 I=60 E=2.73553e-103

xylanase

X.species

NP_644548.1 lcl|xynA-XAC4249

35

258

S=223 I=32 E=6.48777e-20

endo-1,4-beta-xylanase A

X.species

YP_366086.1 lcl|xynA-XCV4355

48

258

S=220 I=32 E=1.4724e-19

endo-1,4-beta-xylanase A

X.species

NP_639454.1 lcl|xynA-XCC4115

35

258

S=176 I=29 E=3.27018e-14

endo-1,4-beta-xylanase A

pubmed

58

330

S=1240 I=86 E=1.64354e-141

Putative xylanase ; degradation

Pubmed 16134895

 

prodomImg

pubmed

31

325

S=955 I=61 E=5.18357e-107

Secreted xylanase ; Signal degradation

Pubmed 16134895

 

prodomImg

pubmed

31

324

S=792 I=50 E=2.60504e-87

Xylanase ; degradation

Pubmed 9294005

 

prodomImg

pubmed

31

324

S=791 I=50 E=3.75705e-87

Xylanase ; degradation

Pubmed 11980475

 

prodomImg

pubmed

30

324

S=692 I=42 E=4.09399e-75

Putative glycosyl hydrolase family10 ; Glycosidase

Pubmed 20072608

 

prodomImg

sp

31

317

S=488 I=38 E=1.52152e-50

Endo-1,4-beta-xylanase B EC=3.2.1.8 ; Carbohydrate metabolism Cellulose degradation Disulfide bond Glycosidase Hydrolase Polysaccharide Signal

 

prodomImg

sp

49

330

S=261 I=30 E=4.38544e-23

Endo-1,4-beta-xylanase A EC=3.2.1.8 ; Disulfide bond Glycosidase Hydrolase Lectin Secreted Signal degradation

 

prodomImg

sp

33

297

S=221 I=27 E=2.9499e-18

Endo-1,4-beta-xylanase A EC=3.2.1.8 ; Cytoplasm Glycosidase Hydrolase degradation

 

prodomImg

sp

52

313

S=221 I=28 E=3.33286e-18

Probable endo-1,4-beta-xylanase C EC=3.2.1.8 ; Disulfide bond Glycosidase Hydrolase Secreted Signal degradation

 

prodomImg

sp

52

313

S=220 I=28 E=3.86534e-18

Probable endo-1,4-beta-xylanase C EC=3.2.1.8 ; Disulfide bond Glycosidase Hydrolase Secreted Signal degradation

 

prodomImg

Iprscan IPR001000 [PR00134]

89

101

Glycoside hydrolase, family 10

Iprscan IPR001000 [PR00134]

130

141

Glycoside hydrolase, family 10

Iprscan IPR001000 [PR00134]

183

194

Glycoside hydrolase, family 10

Iprscan IPR001000 [PR00134]

211

223

Glycoside hydrolase, family 10

Iprscan IPR013781 [G3DSA:3.20.20.80]

26

330

Glycoside hydrolase, subgroup, catalytic core

Iprscan IPR001000 [PF00331]

40

319

Glycoside hydrolase, family 10

Iprscan IPR001000 [SM00633]

58

323

Glycoside hydrolase, family 10

Iprscan [seg]

14

29

-

Iprscan [SignalP-NN(euk)]

1

22

-

Iprscan [tmhmm]

7

29

-

PD614315

157

203

S=217 I=85 E=9.02024e-19

PDA1Y0D8

89

156

S=186 I=51 E=5.14554e-15

PD889591

31

88

S=184 I=61 E=8.68203e-15

PD319386

297

330

S=170 I=97 E=3.81913e-13

PDA1Y0D5

290

325

S=137 I=69 E=4.26322e-09

PD968196

58

140

S=123 I=31 E=2.13737e-07

PD000809

203

290

S=113 I=36 E=3.57207e-06

PD445747

71

91

S=107 I=95 E=1.88861e-05

PDA26435

166

205

S=103 I=45 E=5.918e-05

Iprscan IPR017853 [SSF51445]

22

327

Glycoside hydrolase, catalytic core

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one EZmNdd6v)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

165 hits
swiss-prot

Swiss-Prot ncbi-blastp

40 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

4 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

11 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBoquuP5/XFF4834R_chr41270.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBoquuP5/XFF4834R_chr41270.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBoquuP5/XFF4834R_chr41270.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBoquuP5/XFF4834R_chr41270.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.