Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr41230lacZ1XFF4834R_chr41230putative beta-galactosidase

lacZ1 XFF4834R_chr41230
XFF4834R_chr41220
XFF4834R_chr41220
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr41240
XFF4834R_chr41240
ID lacZ1
AC XFF4834R_chr41230
LT XFF4834R_chr41230
OR XFF4834R_chr from 4787996 to 4790767 on strand -
DE putative beta-galactosidase
IP
CL 1.2.4 Polysaccharides GO:0000272
EC
GO InterPro


Curated
PM
AN
CC COG: [G] Carbohydrate transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by elauber (20110119)
MW 101506.5 Da
SQ 923 aa
 
........10........20........30........40........50
| | | | |
MRARAKHNVTRQLLAACAVRACTGVVWLCSALPIIAAPHAASDASRERIS
LNAQWRFHRGDPPAKQEILDYDVRPQVVRSDDGKVADAQPEHAQHIDASA
VRVLKPWILPTANGLIADPAQRHTRPPGNPGSAVAYVQPYFDDSAWETVD
LPHDWAIAGPFLADGPYGGMGRLPSWGIGWYRKSLDIPASDRGRALFLDL
DGAMSYATVWLNGTLVGGWPYGYSSWRVDLTPYVMAGKRNQLVIRLDNPP
ESARWYPGGGLYRNVWLTKAAPLHIAHWGTQLTTPHVSADAAQVQLTVTL
DNAARSAAQAQVSTAIYLLDDASDRPSGEAVARIPAQPIAVPAGGTAHVQ
GSTRIDAPRLWGPPPTQQPHRYVAITEVGQQGRVVDRYETRFGIRSIVFD
ADKGLLVNGEHVPIRGVNNHHDLGALGAAFNRRAAERQLQLLQQMGANAI
RMSHNPPAPELLELTDRMGLLVVDEVFDSWEMKKTPLDFHLVFPQWHAAD
LRAMLRRDRNHPSVMLWSVGNEVGEQYTGEQGAAIARTLRAIVHAEDPTR
PATVAMNYASPEMPLPAALDVVSLNYQGEGIRDAAEFEGTERIRKPPQYP
AFHARFPHKAIVSSETASALSSRGVYLFPVTPERSAPVRDGRGGDSIAHQ
VSAYELHAVDFGSSADKVFAALDRHPYVAGEFVWTGFDYLGEPTPYYSSR
SSYSGIFDLAGFPKDRYWLYQSRWRPEVPVAHLLPHWSWPGREGQVTPVH
VFTSGDEAELFVNGVSQGRKRKAPLQYRLRWDAVVYQPGELRVQAYKDGK
PWASERVQTAGRAARMQLTPDRGSIRGDGQDLSFITVRLLDRDGRPAPTA
GDRLRFRIEGPGELVATDNGDPTNLETFASSQRHAFNGLCLAIVRAKAGA
RGTITVHVESDTLQAAQTQVAVQ
XFF4834R

XFF4834R_chr31980 lcl|XFF4834R_chr34560105_3674669_f3_XFF4834R-XFF4834R_chr31980

138

895

S=994 I=35 E=1.76138e-113

XFF4834R

XFF4834R_chr07170 lcl|XFF4834R_chr07490900_0824794_f2_XFF4834R-XFF4834R_chr07170

121

913

S=891 I=34 E=6.22775e-101

XFF4834R

XFF4834R_chr13290 lcl|XFF4834R_chr14140724_1525191_f1_XFF4834R-XFF4834R_chr13290

180

250

S=113 I=34 E=1.24009e-06

XFF4834R

XFF4834R_chr13290 lcl|XFF4834R_chr14140724_1525191_f1_XFF4834R-XFF4834R_chr13290

260

400

S=104 I=32 E=1.36377e-05

X.species

YP_366087.1 lcl|bga2-XCV4356

1

913

S=4434 I=92 E=0

beta-galactosidase

X.species

NP_644549.2 lcl|XAC4250-XAC4250

35

913

S=4288 I=94 E=0

beta-galactosidase

X.species

NP_639455.2 lcl|XCC4116

25

913

S=3786 I=80 E=0

beta-galactosidase

X.species

NP_636630.1 lcl|bga-XCC1256

138

896

S=1013 I=35 E=3.58912e-115

beta-galactosidase

X.species

YP_363090.1 lcl|XCV1359

138

895

S=1012 I=36 E=5.26738e-115

putative beta-galactosidase precursor

X.species

NP_641643.1 lcl|bga-XAC1308

138

895

S=998 I=35 E=2.68725e-113

beta-galactosidase

X.species

NP_641061.1 lcl|lacZ-XAC0708

445

913

S=561 I=36 E=2.31552e-60

truncated beta-galactosidase

X.species

NP_641060.1 lcl|lacZ-XAC0707

121

316

S=281 I=36 E=1.67331e-26

truncated beta-galactosidase

X.species

NP_638508.2 lcl|XCC3162

180

250

S=118 I=34 E=9.6682e-07

glycosyl hydrolase

X.species

NP_643619.2 lcl|XAC3312-XAC3312

180

250

S=111 I=35 E=6.99652e-06

glycosyl hydrolase

X.species

YP_365161.1 lcl|XCV3430

180

250

S=109 I=34 E=1.13016e-05

putative O-glycosyl hydrolase

pubmed

2

913

S=3817 I=79 E=0

Beta-galactosidase Gal02II EC=3.2.1.23 ; Glycosidase Hydrolase

Pubmed 15153767

 

prodomImg

pubmed

138

896

S=1013 I=35 E=1.56634e-113

Beta-galactosidase Beta-galactosidase Gal02I EC=3.2.1.23 ; Glycosidase Hydrolase

Pubmed 15153767

 

prodomImg

pubmed

139

913

S=971 I=32 E=1.82486e-108

Beta-galactosidase BbgIII EC=3.2.1.23 ; Glycosidase Hydrolase

Pubmed 17684740

 

prodomImg

pubmed

137

913

S=903 I=31 E=3.36644e-100

Beta-galactosidase ; Cell wall Glycosidase Hydrolase Peptidoglycan-anchor

Pubmed 11004197

 

prodomImg

pubmed

141

896

S=759 I=28 E=9.61521e-83

Beta-galactosidase ; Glycosidase Hydrolase Signal

Pubmed 15175306

 

prodomImg

sp

141

580

S=319 I=24 E=1.32692e-29

Beta-galactosidase EC=3.2.1.23 ; Glycosidase Hydrolase

 

prodomImg

sp

177

615

S=265 I=26 E=5.51638e-23

Beta-glucuronidase EC=3.2.1.31 ; Glycoprotein Glycosidase Hydrolase Lysosome Signal

 

prodomImg

sp

177

615

S=256 I=25 E=6.33688e-22

Beta-glucuronidase EC=3.2.1.31 ; Alternative splicing Disease mutation Glycoprotein Glycosidase Hydrolase Lysosome Mucopolysaccharidosis Polymorp

 

prodomImg

sp

177

615

S=255 I=25 E=7.61013e-22

Beta-glucuronidase EC=3.2.1.31 ; Glycoprotein Glycosidase Hydrolase Lysosome Signal

 

prodomImg

sp

142

550

S=255 I=25 E=8.52347e-22

Beta-galactosidase EC=3.2.1.23 ; Glycosidase Hydrolase

 

prodomImg

PD340433

736

913

S=399 I=45 E=1.13268e-40

PD694492

73

137

S=269 I=82 E=6.50942e-25

PD631351

11

72

S=222 I=65 E=3.11387e-19

PD736581

676

735

S=201 I=63 E=1.16983e-16

PDA4O867

317

354

S=189 I=100 E=3.29879e-15

PD388613

138

180

S=168 I=70 E=1.06858e-12

PD339503

181

268

S=165 I=40 E=2.57777e-12

PD719613

594

669

S=148 I=46 E=3.03713e-10

PD979230

272

344

S=124 I=44 E=2.33227e-07

PDA1T0Q1

476

496

S=123 I=95 E=3.30552e-07

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one QvkXqzq5)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

90 hits
swiss-prot

Swiss-Prot ncbi-blastp

76 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

5 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

0 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB4ZTqxp/XFF4834R_chr41230.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB4ZTqxp/XFF4834R_chr41230.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB4ZTqxp/XFF4834R_chr41230.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB4ZTqxp/XFF4834R_chr41230.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.