Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr40920tatAXFF4834R_chr40920twin arginine translocase protein A

tatA XFF4834R_chr40920
XFF4834R_chr40910
XFF4834R_chr40910
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr40930
XFF4834R_chr40930
ID tatA
AC XFF4834R_chr40920
LT XFF4834R_chr40920
OR XFF4834R_chr from 4750724 to 4750951 on strand -
DE twin arginine translocase protein A
IP Bacterial sec-independent translocation protein mttA/Hcf106; Twin-arginine translocation protein TatA/E
CL 4.2.A.64 The Type V Secretory Pathway or Twin Arginine Targeting (Tat) Family
EC
GO InterPro
Biological Process: protein transport (GO:0015031)
Biological Process: protein secretion (GO:0009306)
Cellular Component: plasma membrane (GO:0005886)
Cellular Component: integral to membrane (GO:0016021)
Molecular Function: protein transporter activity (GO:0008565)

Curated
PM
AN
CC COG: [U] Intracellular trafficking, secretion, and vesicular transport;
CC MODEL: XFF4834R
CC STATUS: curated by jacques (20111025)
MW 8297.4 Da
SQ 75 aa
 
........10........20........30........40........50
| | | | |
MGGFSIWHWLIVLVIVLLVFGTKRLTSGAKDLGSAVKEFKKGMHDDDKPA
GKLGDDSRTAEQAREAQAERDRDAR
Show or not Domain decomposition
 
Hamap TATA_MF_00236 raw_score=1440 norm_score=17.623

Sec-independent protein translocase protein tatA/E homolog [tatA].

X.species

YP_366052.1 lcl|tatA-XCV4321

1

59

S=241 I=83 E=3.63018e-23

twin argininte translocase protein A

X.species

NP_644517.1 lcl|tatA-XAC4218

1

59

S=241 I=83 E=3.63018e-23

twin argininte translocase protein A

X.species

NP_639432.1 lcl|tatA-XCC4093

1

59

S=234 I=80 E=2.84147e-22

twin argininte translocase protein A

X.species

lcl|tatA-XALc_0071

1

59

S=190 I=68 E=5.11932e-17

probable sec-independent protein translocase

pubmed

1

59

S=241 I=83 E=1.65499e-21

TatA Sec-independent protein translocase ; Cell membrane transport Translocation Transmembrane

Pubmed 18998110

 

prodomImg

pubmed

1

57

S=109 I=42 E=1.60479e-05

Twin arginine translocation protein A ; Cell membrane transport Transmembrane

Pubmed 18075090

 

prodomImg

pubmed

1

57

S=109 I=42 E=1.82901e-05

Sec-independent protein translocase protein tatA ; Cell inner membrane transport Translocation Transmembrane

Pubmed 9649434,9546395

 

prodomImg

sp

1

59

S=241 I=83 E=1.08216e-21

Sec-independent protein translocase protein tatA/E homolog ; Cell inner membrane transport Translocation Transmembrane

 

prodomImg

sp

1

59

S=241 I=83 E=1.08216e-21

Sec-independent protein translocase protein tatA/E homolog ; Cell inner membrane transport Translocation Transmembrane

 

prodomImg

sp

1

59

S=241 I=83 E=1.08216e-21

Sec-independent protein translocase protein tatA/E homolog ; Cell inner membrane transport Translocation Transmembrane

 

prodomImg

sp

1

59

S=234 I=80 E=8.47049e-21

Sec-independent protein translocase protein tatA/E homolog ; Cell inner membrane transport Translocation Transmembrane

 

prodomImg

sp

1

59

S=234 I=80 E=8.47049e-21

Sec-independent protein translocase protein tatA/E homolog ; Cell inner membrane transport Translocation Transmembrane

 

prodomImg

Iprscan IPR006312 [MF_00236]

1

74

Twin-arginine translocation protein TatA/E

Iprscan IPR003369 [PF02416]

4

52

Bacterial sec-independent translocation protein mttA/Hcf106

Iprscan IPR006312 [TIGR01411]

3

49

Twin-arginine translocation protein TatA/E

Iprscan [seg]

10

19

-

Iprscan [seg]

60

75

-

Iprscan [tmhmm]

4

21

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one ZdGqJKHA)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

3 hits
swiss-prot

Swiss-Prot ncbi-blastp

79 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

1 hits
Interpro Scan

IprScan

6 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBm4I__c/XFF4834R_chr40920.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBm4I__c/XFF4834R_chr40920.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBm4I__c/XFF4834R_chr40920.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBm4I__c/XFF4834R_chr40920.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.