Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr40910tatBXFF4834R_chr40910sec-independent translocase tatB

tatB XFF4834R_chr40910
XFF4834R_chr40900
XFF4834R_chr40900
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr40920
XFF4834R_chr40920
ID tatB
AC XFF4834R_chr40910
LT XFF4834R_chr40910
OR XFF4834R_chr from 4750082 to 4750708 on strand -
DE sec-independent translocase tatB
IP Bacterial sec-independent translocation protein mttA/Hcf106; Twin-arginine translocation protein TatB
CL 4.2.A.64 The Type V Secretory Pathway or Twin Arginine Targeting (Tat) Family
EC
GO InterPro
Biological Process: protein transport (GO:0015031)
Biological Process: protein secretion (GO:0009306)
Cellular Component: membrane (GO:0016020)
Molecular Function: protein transporter activity (GO:0008565)

Curated
PM
AN
CC COG: [U] Intracellular trafficking, secretion, and vesicular transport;
CC MODEL: XFF4834R
CC STATUS: curated by szurek (20101122)
MW 21987.5 Da
SQ 208 aa
 
........10........20........30........40........50
| | | | |
MFDIGVGELTLIAVVALVVLGPERLPKAARFAGLWVRRARMQWDSVKQEL
ERELEAEELKRSLQDVQASLREAEDQLRNKQQQVEQGARALHDDVSRDID
IRASATPVATSLELAHADLSAGPDVDTAAGATDTAGAAHTAPVIAQAQPI
APAPHHTLVPAPHDTRVPAPHAAHLASAPEAVAVAPVDAGTPDASMPSAP
ARIQEKQP
Hamap TATB_MF_00237 raw_score=2122 norm_score=19.221

Sec-independent protein translocase protein tatB homolog [tatB].

X.species

NP_644516.1 lcl|tatB-XAC4217

1

208

S=540 I=58 E=1.38688e-58

sec-independent translocase

X.species

YP_366051.1 lcl|tatB-XCV4320

1

208

S=530 I=57 E=1.89666e-57

sec-independent translocase

X.species

NP_639431.1 lcl|tatB-XCC4092

1

114

S=363 I=65 E=3.65003e-37

sec-independent translocase

X.species

lcl|tatB-XALc_0072

1

95

S=255 I=56 E=4.81434e-24

probable sec-independent protein translocase

pubmed

1

208

S=492 I=54 E=2.92423e-51

TatB ; Cell membrane Protein transport Translocation Transmembrane

Pubmed 18998110

 

prodomImg

sp

1

208

S=540 I=58 E=3.40225e-57

Sec-independent protein translocase protein tatB homolog ; Cell inner membrane transport Translocation Transmembrane

 

prodomImg

sp

1

208

S=530 I=57 E=4.65283e-56

Sec-independent protein translocase protein tatB homolog ; Cell inner membrane transport Translocation Transmembrane

 

prodomImg

sp

1

208

S=496 I=55 E=7.29734e-52

Sec-independent protein translocase protein tatB homolog ; Cell inner membrane transport Translocation Transmembrane

 

prodomImg

sp

1

114

S=363 I=65 E=8.95415e-36

Sec-independent protein translocase protein tatB homolog ; Cell inner membrane transport Translocation Transmembrane

 

prodomImg

sp

1

114

S=363 I=65 E=8.95415e-36

Sec-independent protein translocase protein tatB homolog ; Cell inner membrane transport Translocation Transmembrane

 

prodomImg

Iprscan [coil]

40

91

-

Iprscan IPR018448 [MF_00237]

1

161

Twin-arginine translocation protein TatB

Iprscan IPR003369 [PF02416]

4

85

Bacterial sec-independent translocation protein mttA/Hcf106

Iprscan IPR018448 [TIGR01410]

2

80

Twin-arginine translocation protein TatB

Iprscan [seg]

9

20

-

Iprscan [seg]

49

59

-

Iprscan [seg]

121

154

-

Iprscan [seg]

167

189

-

PD600358

65

120

S=209 I=78 E=7.52173e-18

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one sAvZtd5T)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

1 hits
swiss-prot

Swiss-Prot ncbi-blastp

11 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

1 hits
Interpro Scan

IprScan

8 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBcqKjJu/XFF4834R_chr40910.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBcqKjJu/XFF4834R_chr40910.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBcqKjJu/XFF4834R_chr40910.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBcqKjJu/XFF4834R_chr40910.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.