Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr40900tatCXFF4834R_chr40900Sec-independent protein translocase TatC

tatC XFF4834R_chr40900
XFF4834R_chr40890
XFF4834R_chr40890
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr40910
XFF4834R_chr40910
ID tatC
AC XFF4834R_chr40900
LT XFF4834R_chr40900
OR XFF4834R_chr from 4749348 to 4750085 on strand -
DE Sec-independent protein translocase TatC
IP Sec-independent periplasmic protein translocase; Sec-independent periplasmic protein translocase, conserved site
CL 4.2.A.64 The Type V Secretory Pathway or Twin Arginine Targeting (Tat) Family
EC
GO InterPro


Curated
PM
AN
CC COG: [U] Intracellular trafficking, secretion, and vesicular transport;
CC MODEL: XFF4834R
CC STATUS: curated by szurek (20101122)
MW 26688.7 Da
SQ 245 aa
 
........10........20........30........40........50
| | | | |
MSLFDDAQAESSLIEHLVELRARLVRALIGLGVVLLALLPFSRAIYSWLA
APLISQLPLGQTMIAMNPAGAFFAPLKLTFFVAVFFSVPWLLYQAWAFVA
PGLYQREKKLAFPLLASAVALFYIGCAFAYFLVLPAVFHFLTTFKPDVIA
ITPDANSYLDFVLAIFFAFGASFELPVALVILVLLGWVTPKQLSEGRGYA
IVGIFILAAVLTPPDVVSQLMLAIPMCLLYELGIMASRAVAPKPA
Show or not Domain decomposition
 
X.species

NP_644515.1 lcl|tatC-XAC4216

1

245

S=1093 I=90 E=1.64075e-125

sec-independent protein translocase

X.species

YP_366050.1 lcl|tatC-XCV4319

1

245

S=1088 I=90 E=6.01493e-125

Sec-independent protein translocase TatC

X.species

NP_639430.1 lcl|tatC-XCC4091

1

243

S=1078 I=88 E=1.15573e-123

sec-independent protein translocase

X.species

lcl|tatC-XALc_0073

6

245

S=903 I=73 E=1.66665e-102

probable sec-independent periplasmic protein translocase

pubmed

1

245

S=1088 I=90 E=2.51226e-123

TatC Sec-independent protein translocase

Pubmed 18998110

 

prodomImg

pubmed

41

238

S=531 I=54 E=7.57478e-56

Twin arginine translocation protein C

Pubmed 18075090

 

prodomImg

pubmed

41

238

S=528 I=52 E=1.49526e-55

Sec-independent protein translocase protein tatC ; Cell inner membrane transport Translocation Transmembrane

Pubmed 9649434,9546395

 

prodomImg

pubmed

41

243

S=504 I=50 E=1.20991e-52

TatC protein

Pubmed 11160097

 

prodomImg

pubmed

42

244

S=349 I=37 E=9.24813e-34

Putative TatC protein

Pubmed 15063808

 

prodomImg

pubmed

62

243

S=312 I=34 E=2.24299e-29

Sec-independent protein translocase protein tatCy ; Cell membrane transport Translocation Transmembrane

Pubmed 9202461

 

prodomImg

pubmed

41

243

S=289 I=35 E=1.72244e-26

TatC

Pubmed 16914272,17906152

 

prodomImg

pubmed

59

243

S=286 I=37 E=3.28356e-26

Sec-independent protein translocase protein TatC

Pubmed 12446909

 

prodomImg

pubmed

48

243

S=269 I=37 E=4.00598e-24

Uncharacterized protein BH0553 ; Cell membrane Transmembrane

Pubmed 10086841

 

prodomImg

pubmed

41

125

S=246 I=54 E=2.60665e-21

TatC

Pubmed 17215357

 

prodomImg

sp

41

243

S=562 I=55 E=9.73852e-60

Sec-independent protein translocase protein tatC ; Cell inner membrane transport Translocation Transmembrane

 

prodomImg

sp

41

238

S=529 I=52 E=9.53826e-56

Sec-independent protein translocase protein tatC ; Cell inner membrane transport Translocation Transmembrane

 

prodomImg

sp

41

238

S=528 I=52 E=1.03169e-55

Sec-independent protein translocase protein tatC ; Cell inner membrane transport Translocation Transmembrane

 

prodomImg

sp

41

238

S=528 I=52 E=1.03169e-55

Sec-independent protein translocase protein tatC ; Cell inner membrane transport Translocation Transmembrane

 

prodomImg

sp

41

234

S=501 I=51 E=2.14055e-52

Sec-independent protein translocase protein tatC homolog ; Cell inner membrane transport Translocation Transmembrane

 

prodomImg

Iprscan IPR002033 [PF00902]

22

225

Sec-independent periplasmic protein translocase

Iprscan IPR019822 [TIGR00945]

13

230

Twin arginine-targeting protein translocase, TatC

Iprscan IPR019820 [PS01218]

158

177

Sec-independent periplasmic protein translocase, conserved site

Iprscan [seg]

17

39

-

Iprscan [tmhmm]

28

50

-

Iprscan [tmhmm]

70

92

-

Iprscan [tmhmm]

112

134

-

Iprscan [tmhmm]

166

188

-

Iprscan [tmhmm]

201

223

-

PD003525

73

182

S=267 I=48 E=6.7347e-25

PD153713

179

240

S=180 I=57 E=2.36448e-14

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one zSqUKNu6)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

48 hits
swiss-prot

Swiss-Prot ncbi-blastp

26 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

9 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBrqQdpw/XFF4834R_chr40900.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBrqQdpw/XFF4834R_chr40900.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBrqQdpw/XFF4834R_chr40900.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBrqQdpw/XFF4834R_chr40900.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.