Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr40810XFF4834R_chr_4723917_4724792_f3_XFF4834R-XFF4834R_chr40810XFF4834R_chr40810probable ABC transporter permease and ATP-binding protein

XFF4834R_chr_4723917_4724792_f3_XFF4834R-XFF4834R_chr40810 XFF4834R_chr40810
XFF4834R_chr40800
XFF4834R_chr40800
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr40820
XFF4834R_chr40820
ID XFF4834R_chr_4723917_4724792_f3_XFF4834R-XFF4834R_chr40810
AC XFF4834R_chr40810
LT XFF4834R_chr40810
OR XFF4834R_chr from 4723917 to 4724792 on strand +
DE probable ABC transporter permease and ATP-binding protein
IP ABC transporter, ABCB2
CL 4.3.A.1 The ATP-binding Cassette (ABC) Superfamily + ABC-type Uptake Permeases GO:0042626
EC
GO InterPro
Biological Process: transport (GO:0006810)
Biological Process: transmembrane transport (GO:0055085)
Cellular Component: integral to membrane (GO:0016021)
Molecular Function: nucleoside-triphosphatase activity (GO:0017111)
Molecular Function: nucleotide binding (GO:0000166)
Molecular Function: ATP binding (GO:0005524)
Molecular Function: ATPase activity (GO:0016887)
coupled to transmembrane movement of substances (GO:0042626)

Curated
PM
AN preuve fonctionnelle coli
CC COG: [V] Defense mechanisms;
CC MODEL: XFF4834R
CC STATUS: curated by poussier (20100713)
MW 31612.9 Da
SQ 291 aa
 
........10........20........30........40........50
| | | | |
MLSAGAYLISRNAMTAGMMVAALSYADQFSTRVGSLIDNAVELKMLGLHL
NRLADITTADEEPARRRLEGALRSAPEVQVKGLGYRYSEWEPWIFRNLSF
TIAPGQSVALVGPSGCGKTTLAKIVLGLLALQEGEVTVTDQPRPVCRSAI
PAEGMAAVMQDDCLFSGTIADNVAFFDSSAELSEIEPAARAAGIHDEILK
MPMGYETLVGDMGSTLSGGQKQRLLLARALYRQPKILVLDEATSHLDSDN
EKVVNDAVMDLEITRIIIAHRKETIAMADRVFDLSTQTWIR
XFF4834R

XFF4834R_chr21930 lcl|msbA-XFF4834R_chr21930

97

282

S=280 I=36 E=1.88152e-27

fused lipid transporter subunits of ABC superfamily: membrane component/ATP-binding component

XFF4834R

XFF4834R_chr36350 lcl|XFF4834R_chr39520766_4211448_f1_XFF4834R-XFF4834R_chr36350

77

284

S=276 I=35 E=5.84461e-27

XFF4834R

XFF4834R_chr23390 lcl|cydD-XFF4834R_chr23390

63

288

S=258 I=33 E=8.41518e-25

fused cysteine transporter subunits of ABC superfamily: membrane component/ATP-binding component

XFF4834R

XFF4834R_chr29850 lcl|XFF4834R_chr32410857_3430626_f1_XFF4834R-XFF4834R_chr29850

102

281

S=242 I=37 E=6.58136e-23

XFF4834R

XFF4834R_chr18320 lcl|XFF4834R_chr19650706_2097538_f2_XFF4834R-XFF4834R_chr18320

77

281

S=239 I=33 E=1.54666e-22

XFF4834R

XFF4834R_chr30390 lcl|XFF4834R_chr33000899_3492779_f3_XFF4834R-XFF4834R_chr30390

83

285

S=232 I=31 E=1.0809e-21

XFF4834R

XFF4834R_chr08530 lcl|XFF4834R_chr09110803_0990561_r1_XFF4834R-XFF4834R_chr08530

74

287

S=184 I=30 E=7.85767e-16

XFF4834R

XFF4834R_chr14330 lcl|ssuB-XFF4834R_chr14330

78

284

S=172 I=30 E=2.21577e-14

alkanesulfonate transporter subunit

XFF4834R

XFF4834R_chr10260 lcl|cysA-XFF4834R_chr10260

97

281

S=160 I=28 E=5.67682e-13

sulfate/thiosulfate transporter subunit

XFF4834R

XFF4834R_chr08340 lcl|tauB-XFF4834R_chr08340

74

285

S=155 I=27 E=2.52114e-12

taurine transporter subunit

X.species

NP_644508.1 lcl|cvaB-XAC4209

1

291

S=1420 I=92 E=4.33121e-165

colicin V secretion ABC transporter ATP-binding protein

X.species

lcl|XALc_1903

5

284

S=672 I=52 E=2.23826e-74

hypothetical protein

X.species

lcl|raxB2-XALc_2563

5

282

S=659 I=51 E=8.41581e-73

probable abc transporter permease and atp-binding peptide transport system, abc transporter, atp-binding protein

X.species

lcl|raxB1-XALc_1791

1

284

S=658 I=48 E=9.34403e-73

probable abc transporter permease and atp-binding peptide transport system, abc transporter, atp-binding protein

X.species

YP_362977.1 lcl|raxB-XCV1246

6

284

S=640 I=43 E=1.53334e-70

ABC transporter permease and ATP-binding protein RaxB

X.species

NP_642519.1 lcl|hlyB-XAC2202

5

282

S=355 I=32 E=4.83601e-36

hemolysin secretion protein B

X.species

NP_639046.1 lcl|msbA-XCC3700

77

284

S=290 I=36 E=4.10609e-28

ATP binding transporter 1

X.species

lcl|XALc_1815

97

282

S=283 I=37 E=3.05017e-27

putative atp-binding abc transporter abc transporter, atp-binding protein

X.species

YP_363985.1 lcl|msbA-XCV2254

97

282

S=276 I=35 E=1.72917e-26

Lipid A export ATP-binding/permease protein

X.species

NP_642408.1 lcl|msbA-XAC2087

97

282

S=275 I=35 E=2.30565e-26

ABC transporter ATP-binding protein

pubmed

6

284

S=646 I=44 E=1.2791e-69

Putative ABC transporter protein RaxB ; ATP-binding Nucleotide-binding

Pubmed 15195942

 

prodomImg

pubmed

1

284

S=613 I=44 E=1.17862e-65

McbB ; ATP-binding Nucleotide-binding

Pubmed 19781080

 

prodomImg

pubmed

1

284

S=609 I=44 E=3.85779e-65

McbB ; ATP-binding Nucleotide-binding

Pubmed 19781080

 

prodomImg

pubmed

1

284

S=508 I=42 E=6.11586e-53

MceG ; ATP-binding Nucleotide-binding

Pubmed 9864332,11679081

 

prodomImg

pubmed

1

284

S=504 I=42 E=2.05486e-52

ABC transporter protein MchF ; ATP-binding Nucleotide-binding

Pubmed 12949180

 

prodomImg

sp

1

284

S=498 I=43 E=6.664e-52

Colicin V secretion/processing ATP-binding protein cvaB EC=3.4.22.- ; Bacteriocin transport Cell membrane Hydrolase Nucleotide-binding Plasmid

 

prodomImg

sp

1

284

S=497 I=42 E=9.04197e-52

Probable microcin-H47 secretion/processing ATP-binding protein mchF EC=3.4.22.- ; Bacteriocin transport Cell membrane Hydrolase Nucleotide-bind

 

prodomImg

sp

6

282

S=367 I=32 E=4.88868e-36

ATP-binding cassette sub-family B member 6, mitochondrial ; Membrane Mitochondrion outer Nucleotide-binding Transmembrane Transport

 

prodomImg

sp

77

290

S=367 I=41 E=5.6205e-36

Multidrug resistance protein 1 EC=3.6.3.44 ; ATP-binding Glycoprotein Hydrolase Membrane Nucleotide-binding Repeat Transmembrane Transport

 

prodomImg

sp

77

281

S=307 I=37 E=1.08395e-28

Multidrug resistance protein 1 EC=3.6.3.44 ; ATP-binding Glycoprotein Hydrolase Membrane Nucleotide-binding Repeat Transmembrane Transport

 

prodomImg

Iprscan [G3DSA:3.40.50.300]

85

290

-

Iprscan [PTHR19242:SF58]

1

281

-

Iprscan [PTHR19242]

1

281

-

Iprscan IPR003439 [PF00005]

119

244

ABC transporter-like

Iprscan IPR003593 [SM00382]

104

288

ATPase, AAA+ type, core

Iprscan IPR017871 [PS00211]

216

230

ABC transporter, conserved site

Iprscan IPR003439 [PS50893]

78

290

ABC transporter-like

Iprscan IPR017940 [PS50929]

1

45

ABC transporter integral membrane type 1

Iprscan [seg]

223

230

-

Iprscan [SignalP-NN(euk)]

1

26

-

PDA3M3Y3

259

291

S=156 I=91 E=2.1947e-11

PD573218

28

94

S=123 I=39 E=2.00474e-07

PD710448

97

140

S=111 I=52 E=6.22217e-06

PDA1H4J5

181

214

S=108 I=59 E=1.46224e-05

PDA0I0J1

216

286

S=102 I=36 E=7.59747e-05

PDA0H4W5

78

135

S=102 I=35 E=8.07559e-05

Iprscan [SSF52540]

76

290

-

Iprscan IPR011527 [SSF90123]

1

63

ABC transporter, transmembrane domain, type 1

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 5OdKl0qk)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

0 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

36 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

12 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB7Zjzin/XFF4834R_chr40810.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB7Zjzin/XFF4834R_chr40810.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB7Zjzin/XFF4834R_chr40810.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB7Zjzin/XFF4834R_chr40810.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.