Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr40800XFF4834R_chr_4722696_4723856_f3_XFF4834R-XFF4834R_chr40800XFF4834R_chr40800probable ABC transporter permease and ATP-binding protein

XFF4834R_chr_4722696_4723856_f3_XFF4834R-XFF4834R_chr40800 XFF4834R_chr40800
XFF4834R_chr40790
XFF4834R_chr40790
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr40810
XFF4834R_chr40810
ID XFF4834R_chr_4722696_4723856_f3_XFF4834R-XFF4834R_chr40800
AC XFF4834R_chr40800
LT XFF4834R_chr40800
OR XFF4834R_chr from 4722753 to 4723856 on strand +
DE probable ABC transporter permease and ATP-binding protein
IP Peptidase C39, ABC-type bacteriocin transporter; ABC transporter, transmembrane domain, type 1
CL 4.3.A.1 The ATP-binding Cassette (ABC) Superfamily + ABC-type Uptake Permeases GO:0042626
EC
GO InterPro
Biological Process: proteolysis (GO:0006508)
Biological Process: transport (GO:0006810)
Biological Process: transmembrane transport (GO:0055085)
Cellular Component: integral to membrane (GO:0016021)
Molecular Function: peptidase activity (GO:0008233)
Molecular Function: ATP binding (GO:0005524)
coupled to transmembrane movement of substances (GO:0042626)

Curated
PM
AN start modifie car N-ter trop long par rapport aux orthologues. Deletion de 19aa.
CC COG: [V] Defense mechanisms;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120511)
MW 40151.7 Da
SQ 367 aa
 
........10........20........30........40........50
| | | | |
MQSEAAECALACLAMLAQFYGNECGLPALRRRYSSTLKGMSLNQVIEVAD
DMGFDCRALRAELDYLREVQAPVILHWNMNHFVVLAGTKGSKLVIIDPAQ
GRRLMPMGEASKYFTGVLLELEPSTSFRRASKSPTVPLSALTGRISGLKR
VLIQIFALALAIEALGLSIPLQAQWAVDQISESNGKVILTVAAIFSLVII
IQAGLNLARAWLISWLGANISTQWVINIFSHLIRLPLDFFEKRHLGDIMS
RFGSIHWIQAILTGSFVTALLDGLTGSLALVLLFIYSTGMASVAVVVATL
YALGRFLMFGALWRASEQSMVLDARQQSELMESVRGIQAIKLANRQLERR
ARLANATLEAAKCGVTS
X.species

NP_644508.1 lcl|cvaB-XAC4209

151

367

S=1062 I=96 E=1.39241e-121

colicin V secretion ABC transporter ATP-binding protein

X.species

lcl|raxB1-XALc_1791

19

361

S=954 I=53 E=1.75823e-108

probable abc transporter permease and atp-binding peptide transport system, abc transporter, atp-binding protein

X.species

YP_362977.1 lcl|raxB-XCV1246

18

350

S=709 I=42 E=9.31407e-79

ABC transporter permease and ATP-binding protein RaxB

X.species

lcl|raxB2-XALc_2563

20

355

S=700 I=41 E=1.25175e-77

probable abc transporter permease and atp-binding peptide transport system, abc transporter, atp-binding protein

X.species

lcl|XALc_1904

19

284

S=585 I=43 E=1.07611e-63

hypothetical protein

X.species

NP_642519.1 lcl|hlyB-XAC2202

84

341

S=192 I=26 E=3.92777e-16

hemolysin secretion protein B

X.species

lcl|XALc_1903

300

359

S=107 I=40 E=7.55602e-06

hypothetical protein

pubmed

18

350

S=692 I=41 E=3.9853e-75

Putative ABC transporter protein RaxB ; ATP-binding Nucleotide-binding

Pubmed 15195942

 

prodomImg

pubmed

18

351

S=631 I=40 E=1.13786e-67

McbB ; ATP-binding Nucleotide-binding

Pubmed 19781080

 

prodomImg

pubmed

18

351

S=630 I=40 E=1.26336e-67

McbB ; ATP-binding Nucleotide-binding

Pubmed 19781080

 

prodomImg

pubmed

20

365

S=564 I=34 E=1.45545e-59

MceG ; ATP-binding Nucleotide-binding

Pubmed 9864332,11679081

 

prodomImg

pubmed

20

365

S=557 I=34 E=9.32228e-59

ABC transporter protein MchF ; ATP-binding Nucleotide-binding

Pubmed 12949180

 

prodomImg

sp

20

365

S=554 I=34 E=1.68445e-58

Probable microcin-H47 secretion/processing ATP-binding protein mchF EC=3.4.22.- ; Bacteriocin transport Cell membrane Hydrolase Nucleotide-bind

 

prodomImg

sp

20

365

S=548 I=34 E=7.81418e-58

Colicin V secretion/processing ATP-binding protein cvaB EC=3.4.22.- ; Bacteriocin transport Cell membrane Hydrolase Nucleotide-binding Plasmid

 

prodomImg

sp

18

344

S=255 I=28 E=2.44108e-22

Lactococcin-G-processing and transport ATP-binding protein lagD EC=3.4.22.- ; Antibiotic biosynthesis Bacteriocin Cell membrane Hydrolase Nucleotide-bin

 

prodomImg

sp

19

366

S=255 I=24 E=2.50577e-22

Transport/processing ATP-binding protein comA EC=3.4.22.- ; Cell membrane Competence Hydrolase Nucleotide-binding Protease Thiol Transmembrane

 

prodomImg

sp

19

366

S=254 I=24 E=3.3704e-22

Transport/processing ATP-binding protein comA EC=3.4.22.- ; Cell membrane Competence Hydrolase Nucleotide-binding Protease Thiol Transmembrane

 

prodomImg

Iprscan [coil]

337

358

-

Iprscan [PTHR19242:SF58]

111

355

-

Iprscan [PTHR19242]

111

355

-

Iprscan IPR005074 [PF03412]

2

125

Peptidase C39, bacteriocin processing

Iprscan IPR001140 [PF00664]

152

362

ABC transporter, transmembrane domain

Iprscan IPR017940 [PS50929]

153

367

ABC transporter integral membrane type 1

Iprscan IPR005074 [PS50990]

2

121

Peptidase C39, bacteriocin processing

Iprscan [seg]

4

17

-

Iprscan [tmhmm]

151

173

-

Iprscan [tmhmm]

188

207

-

Iprscan [tmhmm]

212

234

-

Iprscan [tmhmm]

249

271

-

Iprscan [tmhmm]

278

300

-

PDA7F8A1

151

188

S=178 I=97 E=5.20522e-14

PDA4T2E8

120

240

S=165 I=31 E=1.80945e-12

PDA1O437

239

356

S=158 I=33 E=1.35591e-11

PD545493

52

126

S=134 I=37 E=8.67021e-09

PD479847

300

355

S=130 I=48 E=2.69324e-08

Iprscan IPR011527 [SSF90123]

120

365

ABC transporter, transmembrane domain, type 1

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one r9K93Kqc)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

135 hits
swiss-prot

Swiss-Prot ncbi-blastp

47 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

14 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBVMxcac/XFF4834R_chr40800.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBVMxcac/XFF4834R_chr40800.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBVMxcac/XFF4834R_chr40800.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBVMxcac/XFF4834R_chr40800.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.