Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr40750XFF4834R_chr_4717012_4718793_r1_XFF4834R-XFF4834R_chr40750XFF4834R_chr40750putative outer membrane protein, xanthomonadin biosynthesis

XFF4834R_chr_4717012_4718793_r1_XFF4834R-XFF4834R_chr40750 XFF4834R_chr40750
XFF4834R_chr40740
XFF4834R_chr40740
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr40760
XFF4834R_chr40760
ID XFF4834R_chr_4717012_4718793_r1_XFF4834R-XFF4834R_chr40750
AC XFF4834R_chr40750
LT XFF4834R_chr40750
OR XFF4834R_chr from 4717012 to 4718793 on strand -
DE putative outer membrane protein, xanthomonadin biosynthesis
IP Outer membrane assembly protein, YaeT
CL 7.4 Outer membrane GO:0009279
EC
GO InterPro
Cellular Component: outer membrane (GO:0019867)

Curated
PM
AN orthologous to orf1 of pig cluster: XOO4060 and Xcc4085
CC COG: [M] Cell wall/membrane/envelope biogenesis;
CC MODEL: XFF4834R
CC STATUS: curated by jacques (20101118)
MW 66522.7 Da
SQ 593 aa
 
........10........20........30........40........50
| | | | |
MLKVAFALSLLCTLFVPLQAVARATIDKIEIKGLDGGDDAEMIENIQVSL
SLYEAVGKEQGESRLEYLLAQAERQTREALEPFGYYSPTITLAAPRAGDK
VTVVITVDRGEPVRVRTSHISITGWAEQDRYLGQDLKQFEPREGQVFSHP
QYEASKVRITRRLAERGYFDADFTQRRVAITRAEHAADIDLNWDSGRRYD
MGKVRFDYDYFRDGLFDPLVYWDEGSYYHEGKLDRLRESLTKLDYFSTID
IQPKPEEADDQGRVPVDVKLTRAKRTVYTSGLSYGSESGAGVRGGVERRY
VNARGHKMDTQLDYAQNRKSLTTSYRVPAFRWLDGWYTASARLYDEQTEY
IDLRNVKLTGSRSGQINERWSAIASINALRERWRFSSGDDFEGAVYETST
LIYPQLQANYVNVDDRLFPRSGVSAQMFIRGGAEGAGSDTNFGQLYGQLR
WFLGAGDNGRLILRGEGGTTWTSDLVAMPPSLRFFAGGANSIRGYAFREV
GPRTPKPDEFALGAKNVVTASAEYEHYLKGGPWGGAVFVDGGSAFDNTPD
WHTGIGFGLRWRSPVGPVRVDIAHGLNDPDSQFQLYIDIGANL
XFF4834R

XFF4834R_chr30840 lcl|bamA-XFF4834R_chr30840

456

581

S=123 I=30 E=3.7198e-08

conserved protein

XFF4834R

XFF4834R_chr30840 lcl|bamA-XFF4834R_chr30840

99

330

S=104 I=23 E=8.80356e-06

conserved protein

X.species

NP_644503.1 lcl|XAC4204-XAC4204

1

593

S=3092 I=99 E=0

hypothetical protein

X.species

YP_366037.1 lcl|XCV4306

1

593

S=3075 I=98 E=0

putative outer membrane protein

X.species

NP_639424.1 lcl|XCC4085

1

593

S=2907 I=93 E=0

hypothetical protein

X.species

lcl|XALc_3135

20

593

S=2295 I=74 E=0

putative outer membrane protein

X.species

YP_363201.1 lcl|oma-XCV1470

450

581

S=127 I=30 E=5.3532e-08

outer membrane antigen

X.species

YP_363201.1 lcl|oma-XCV1470

99

330

S=104 I=23 E=3.30573e-05

outer membrane antigen

X.species

NP_641748.1 lcl|oma-XAC1413

450

581

S=123 I=29 E=1.44636e-07

outer membrane antigen

X.species

NP_641748.1 lcl|oma-XAC1413

99

330

S=104 I=23 E=3.36388e-05

outer membrane antigen

X.species

lcl|XALc_2034

478

581

S=112 I=31 E=3.80377e-06

putative outer membrane antigen precursor protein

X.species

NP_636739.1 lcl|oma-XCC1365

450

581

S=112 I=29 E=3.83708e-06

outer membrane antigen

pubmed

1

593

S=3054 I=97 E=0

Putative outer membrane protein

Pubmed 12057948

 

prodomImg

pubmed

1

593

S=523 I=26 E=2.41455e-54

Uncharacterized protein HI_0698 ; Signal

Pubmed 10675023

 

prodomImg

pubmed

111

593

S=462 I=26 E=6.15518e-47

HI0698-like protein

Pubmed 16714566

 

prodomImg

pubmed

88

571

S=178 I=23 E=1.36971e-12

Putative bacterial surface antigen family protein

Pubmed 19151139

 

prodomImg

pubmed

99

298

S=129 I=25 E=1.41123e-06

Outer membrane protein assembly factor yaeT ; Cell Signal

Pubmed 11179681

 

prodomImg

sp

10

593

S=605 I=30 E=1.62799e-64

Uncharacterized protein ytfM ; Signal

 

prodomImg

sp

10

593

S=605 I=30 E=1.62799e-64

Uncharacterized protein ytfM ; Signal

 

prodomImg

sp

1

593

S=523 I=26 E=1.64286e-54

Uncharacterized protein HI_0698 ; Signal

 

prodomImg

sp

99

516

S=167 I=23 E=2.02314e-11

Outer membrane protein assembly factor yaeT ; Cell Signal

 

prodomImg

sp

99

503

S=150 I=22 E=2.7887e-09

Outer membrane protein assembly factor yaeT ; Cell Signal

 

prodomImg

Iprscan IPR000184 [PTHR12815]

325

591

Bacterial surface antigen (D15)

Iprscan IPR000184 [PF01103]

301

591

Bacterial surface antigen (D15)

Iprscan IPR010827 [PF07244]

117

194

Surface antigen variable number

Iprscan [SignalP-NN(euk)]

1

24

-

PDA1K1Y5

208

277

S=355 I=96 E=1.77621e-35

PD296020

68

160

S=172 I=42 E=3.15498e-13

PD717991

11

58

S=147 I=67 E=2.85929e-10

PDA1Q564

504

532

S=147 I=93 E=3.40398e-10

PDA1G0V7

165

207

S=141 I=60 E=1.64947e-09

PDA1Y0Y2

1

27

S=130 I=96 E=3.42806e-08

PD331895

142

269

S=115 I=23 E=2.61181e-06

PDA1F7S8

533

576

S=112 I=54 E=4.89294e-06

PDA1T3E8

504

533

S=108 I=70 E=1.77817e-05

PD584899

280

390

S=106 I=29 E=3.00029e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one vAuqpdbR)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

7 hits
swiss-prot

Swiss-Prot ncbi-blastp

66 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

2 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

4 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBNSIw6F/XFF4834R_chr40750.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBNSIw6F/XFF4834R_chr40750.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBNSIw6F/XFF4834R_chr40750.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBNSIw6F/XFF4834R_chr40750.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.