Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr40740XFF4834R_chr_4713161_4716931_r3_XFF4834R-XFF4834R_chr40740XFF4834R_chr40740putative periplasmic protein, xanthomonadin biosynthesis

XFF4834R_chr_4713161_4716931_r3_XFF4834R-XFF4834R_chr40740 XFF4834R_chr40740
XFF4834R_chr40730
XFF4834R_chr40730
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr40750
XFF4834R_chr40750
ID XFF4834R_chr_4713161_4716931_r3_XFF4834R-XFF4834R_chr40740
AC XFF4834R_chr40740
LT XFF4834R_chr40740
OR XFF4834R_chr from 4713161 to 4717015 on strand -
DE putative periplasmic protein, xanthomonadin biosynthesis
IP Protein of unknown function DUF490
CL 7.2 Periplasmic space GO:0042597
EC
GO InterPro


Curated
PM
AN orthologous to orf2 of the pig cluste:XOO4061 and XCC4084
CC COG: [S] Function unknown;
CC MODEL: XFF4834R
CC STATUS: curated by jacques (20101118)
MW 136522.9 Da
SQ 1284 aa
 
........10........20........30........40........50
| | | | |
VSTPTPPPAPRRARFYRRRRFWVGSGLTVLGLVLLALIAIYWLLQTVAGR
DVLLAQVTARLPVGATFTYGKVEGPVAGPLTLRDVDFHYQDIHFTAERVY
LEPDLRPLLGRKLQLDAVQVSNATLNLGKSEEPFTLPSWPESLPQINVPL
AIQADKIDVQNLRITQLQQPMIVLHKVQGGLDVATGELRTRDLVIDTDMG
DFRLHGDYLPNDDYRADLTATAVLPAARGRTPASLGLVARGDLDKMEVAI
AGRAPAPLQASLVFTGRDDPTWAFKAVTEALDTSLLIPAAEGQANPPATP
IALNLQASAKGGNADLHGSIRQGELSATLQPSHIALADQVLTVEPLVIDT
FEGRTQLRGTADFRDTQNPSFRFAVNASGLRFTPAADPATPDAPLVPVEL
QDARLGVAGTLKAWAAIGRATVERDGQQAELVFDSRGNDQGAQLKQVQAK
TPGGSLDLTGEVAWAPALQWDVSAQLAKFDPGYFAPGWNGNLSGRIASKG
HQLPAPAGGVSPGFEATAEIPSLTGQLRQRALSGNGKFALRGQQGEGELQ
LALGNSRINAKGKVGDQLDIAAQLQPLQLDDVLPGATGVVRGQLQVSGKR
DAPDINADITGNGLRWDTYSAQSISLRGRLPWRGSDGQLALQGTAIEAGV
VLDSVRVQARGAVESLRLDADIANSMASVALQGDVHRNGERWQGQVATLR
IAPAKGDAWALRQPAQFSTDGAAFTLSDTCLGAATGGALCASANWPREGM
VVHGEALPLSLVQPWLPKQEGRQIYLRGELSLDGSFKPRGNAWEGSLRIA
SPEGGIRLGETRYAAVAGNPNRGELLRYDQFSVQADFTQQQIQGKLGIGF
QGAGFVDAKFNTGWDAYAPLNGELYLNMSRLYWLELVIADVVRPKGLVEG
HVSLRGTRDKPLLGGDATLSDFTAEYPSMGLTLSEGKGRFDALPDGSAKI
TASAKSGPGTLTVDGGLSWFGTSTPLLLNIRGDNVLAYNTSELRIIANPD
MQFGITDNTMQLRGKVTVPEADIDLERLDRGTSVSEDVVVLDPVDPEQTP
ASPLDMDLAIVLGDKVNMSGFGLKGGLSGQMQIRARPGREMTANGGLDVR
GRYKAYGQDLTISRGQLTWNNNIVSDPRVSLRAERKIGDVTAGIDVSGRA
ESPRADVWSEPAMSQSEALSYLVLGRGLSTASSDETQQVSAASAALSAGS
SLIASQIGAKLGLDEAGVSQSSTLGSVVGFGKYLSPKLYVGYGVSMVGGG
SVLTLKYLLSRGFDIEAESSTIETKGSVNWRREK
X.species

NP_644502.2 lcl|XAC4203-XAC4203

38

1284

S=5836 I=92 E=0

hypothetical protein

X.species

YP_366036.1 lcl|XCV4305

38

1284

S=5776 I=90 E=0

hypothetical protein

X.species

NP_639423.2 lcl|XCC4084

41

1284

S=5414 I=85 E=0

hypothetical protein

X.species

lcl|XALc_3136

38

1284

S=3686 I=57 E=0

hypothetical protein

pubmed

101

1284

S=5343 I=88 E=0

Putative periplasmic protein

Pubmed 12057948

 

prodomImg

pubmed

773

1269

S=377 I=26 E=2.91251e-36

Putative uncharacterized protein

Pubmed 16584799

 

prodomImg

pubmed

896

1181

S=209 I=25 E=5.55633e-16

Uncharacterized protein HI_0696

Pubmed 10675023

 

prodomImg

pubmed

395

708

S=150 I=20 E=7.69372e-09

Uncharacterized protein HI_0696

Pubmed 10675023

 

prodomImg

pubmed

66

708

S=174 I=21 E=1.21373e-11

HI0696-like protein

Pubmed 16714566

 

prodomImg

sp

402

1184

S=382 I=23 E=4.88364e-37

Uncharacterized protein ytfN

 

prodomImg

sp

896

1181

S=209 I=25 E=3.79221e-16

Uncharacterized protein HI_0696

 

prodomImg

sp

395

708

S=150 I=20 E=5.25098e-09

Uncharacterized protein HI_0696

 

prodomImg

Iprscan IPR007452 [PF04357]

954

1283

Protein of unknown function DUF490

Iprscan [seg]

3

21

-

Iprscan [seg]

23

37

-

Iprscan [seg]

383

394

-

Iprscan [seg]

566

581

-

Iprscan [seg]

729

741

-

Iprscan [seg]

1033

1047

-

Iprscan [seg]

1190

1209

-

Iprscan [seg]

1239

1252

-

Iprscan [SignalP-NN(euk)]

1

49

-

Iprscan [tmhmm]

21

43

-

PD322329

170

518

S=1171 I=64 E=4.98885e-134

PD416673

785

894

S=525 I=87 E=7.35546e-56

PD278822

1066

1271

S=320 I=42 E=5.54559e-31

PD912952

116

169

S=218 I=72 E=1.40779e-18

PDA0N4D4

881

1028

S=199 I=35 E=2.89796e-16

PDA3H6L2

45

105

S=193 I=56 E=1.26477e-15

PD644142

478

616

S=166 I=33 E=2.91359e-12

PD871874

619

782

S=148 I=31 E=3.84478e-10

PDA3H6L1

519

548

S=148 I=100 E=3.87844e-10

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one pxocItmV)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

5 hits
swiss-prot

Swiss-Prot ncbi-blastp

3 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

11 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBqem9NI/XFF4834R_chr40740.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBqem9NI/XFF4834R_chr40740.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBqem9NI/XFF4834R_chr40740.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBqem9NI/XFF4834R_chr40740.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.