Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr40450actPXFF4834R_chr40450probable cation/acetate symporter protein

actP XFF4834R_chr40450
XFF4834R_chr40440
XFF4834R_chr40440
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr40460
XFF4834R_chr40460
ID actP
AC XFF4834R_chr40450
LT XFF4834R_chr40450
OR XFF4834R_chr from 4677014 to 4678741 on strand -
DE probable cation/acetate symporter protein
IP Sodium/solute symporter; Sodium/solute symporter, conserved site
CL 4.S.194 acetate
EC
GO InterPro
Biological Process: transport (GO:0006810)
Biological Process: transmembrane transport (GO:0055085)
Cellular Component: membrane (GO:0016020)
Molecular Function: transporter activity (GO:0005215)

Curated
PM
AN
CC COG: [R] General function prediction only;
CC MODEL: XFF4834R
CC STATUS: curated by pieretti (20101004)
MW 59820 Da
SQ 575 aa
 
........10........20........30........40........50
| | | | |
MSKYSRLLLILAGLLPAGIALAAGGDMGQVDKQPTNWVAIGMFGFFVLGT
LWITKWAAAKTKSAADFYTAGGGITGFQNGLAIAGDFMSAASFLGITAAV
MANGYDGLIYAIGFLVGWPILTFLMAERLRNLGKYTFADVAGYRFAPTAI
RSFAASGTLVVVLFYLIAQMVGAGALIKLLFGLDYWVAVTLVGVLMMIYV
LFGGMTATTWVQIIKAVLLLTGVTFMAVAIMWHFNFSFEALFAEGVRVKT
AVAASGGASPEDAAKAGLSIMGPGGFVKDPISAISFGMALMFGTAGLPHI
LMRFFTVPDAKQARKSVLWATTWIGYFYILIFIIGFGAIALVLTNPQFAD
VATGTIHGGKGAANMAAVLVGNAVGGNVFMGFISAVAFATILAVVAGLTL
SGASAVSHDLYATVIKKGNPAPGSELKVSRATTLVLGVIAVLLGIVFEKQ
NVAFMVSLAFAIAASANFPVLILSLLWKNCTTRGAVIGGFLGLISSLVLT
ILSPSVWVDTLGNAAGSAPFPYTSPALFSMTIGFVGIWLFSVLDRSPQAA
NERAAFKAQQIRAETGLGASGASGH
X.species

NP_644475.2 lcl|actP-XAC4176

1

575

S=2419 I=85 E=0

acetate permease

X.species

YP_366003.1 lcl|actP-XCV4272

1

575

S=2407 I=85 E=0

acetate permease

X.species

NP_639396.2 lcl|actP-XCC4057

1

575

S=2402 I=84 E=0

acetate permease

X.species

lcl|actP-XALc_0094

26

575

S=2249 I=82 E=0

probable cation/acetate symporter protein

pubmed

28

575

S=1785 I=67 E=0

Transmembrane protein DhlC homolog

Pubmed 9256491

 

prodomImg

pubmed

28

575

S=1459 I=57 E=7.83112e-168

Cation/acetate symporter actP ; Cell inner membrane transport Sodium Transmembrane

Pubmed 8265357

 

prodomImg

pubmed

36

575

S=1372 I=55 E=2.67843e-157

PaaL

Pubmed 9600981

 

prodomImg

pubmed

33

575

S=1360 I=55 E=8.09849e-156

PaaL

Pubmed 17377771

 

prodomImg

pubmed

33

575

S=1351 I=55 E=8.5263e-155

Putative phenylacetic acid permease

Pubmed 9495743

 

prodomImg

pubmed

36

575

S=1310 I=56 E=7.98806e-150

Putative phenylacetic acid permease

Pubmed 15474299

 

prodomImg

pubmed

26

575

S=1210 I=49 E=1.04534e-137

Putative amino acid transport protein Sodium solute symporter family protein

Pubmed 11208781

 

prodomImg

pubmed

66

321

S=648 I=54 E=1.55415e-69

Uncharacterized symporter ywcA ; Cell membrane Ion transport Sodium Transmembrane

Pubmed 7934828

 

prodomImg

pubmed

382

567

S=297 I=43 E=5.31257e-27

Uncharacterized symporter ywcA ; Cell membrane Ion transport Sodium Transmembrane

Pubmed 7934828

 

prodomImg

pubmed

66

319

S=509 I=45 E=1.08111e-52

DhlC protein

Pubmed 7580000

 

prodomImg

sp

28

575

S=1495 I=58 E=2.69125e-172

Cation/acetate symporter actP ; Cell inner membrane transport Sodium Transmembrane

 

prodomImg

sp

28

575

S=1480 I=57 E=1.56482e-170

Cation/acetate symporter actP ; Cell inner membrane transport Sodium Transmembrane

 

prodomImg

sp

28

575

S=1472 I=56 E=1.52315e-169

Cation/acetate symporter actP ; Cell inner membrane transport Sodium Transmembrane

 

prodomImg

sp

28

575

S=1472 I=57 E=1.61901e-169

Cation/acetate symporter actP ; Cell inner membrane transport Sodium Transmembrane

 

prodomImg

sp

28

575

S=1472 I=57 E=1.61901e-169

Cation/acetate symporter actP ; Cell inner membrane transport Sodium Transmembrane

 

prodomImg

Iprscan IPR001734 [PF00474]

67

492

Sodium/solute symporter

Iprscan IPR019900 [TIGR00813]

67

492

Sodium/solute symporter, subgroup

Iprscan IPR018212 [PS00456]

182

207

Sodium/solute symporter, conserved site

Iprscan IPR001734 [PS50283]

36

506

Sodium/solute symporter

Iprscan [seg]

7

25

-

Iprscan [seg]

54

65

-

Iprscan [seg]

324

341

-

Iprscan [seg]

361

378

-

Iprscan [seg]

431

446

-

Iprscan [tmhmm]

7

24

-

Iprscan [tmhmm]

37

59

-

Iprscan [tmhmm]

80

102

-

Iprscan [tmhmm]

107

129

-

Iprscan [tmhmm]

149

171

-

Iprscan [tmhmm]

181

203

-

Iprscan [tmhmm]

210

232

-

Iprscan [tmhmm]

280

302

-

Iprscan [tmhmm]

322

344

-

Iprscan [tmhmm]

385

407

-

Iprscan [tmhmm]

428

445

-

Iprscan [tmhmm]

455

477

-

Iprscan [tmhmm]

484

506

-

Iprscan [tmhmm]

521

543

-

PD885391

205

317

S=268 I=57 E=7.16201e-25

PDA1F7Q6

80

126

S=150 I=66 E=1.23678e-10

PDA1Q0T6

127

185

S=144 I=51 E=7.19727e-10

PD808211

477

549

S=133 I=41 E=1.64635e-08

PD859754

150

204

S=131 I=61 E=2.41618e-08

PDA1F979

447

475

S=127 I=93 E=7.97775e-08

PDA0S9Q2

66

223

S=123 I=28 E=2.19339e-07

PDA1U7W3

127

150

S=123 I=100 E=2.45663e-07

PDA1G7A1

543

575

S=117 I=73 E=1.11021e-06

PD862026

274

314

S=107 I=44 E=2.30733e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one jPQlU0uN)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

21 hits
swiss-prot

Swiss-Prot ncbi-blastp

75 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

23 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB5U5FQR/XFF4834R_chr40450.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB5U5FQR/XFF4834R_chr40450.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB5U5FQR/XFF4834R_chr40450.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB5U5FQR/XFF4834R_chr40450.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.