Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr40440XFF4834R_chr_4675416_4676516_r2_XFF4834R-XFF4834R_chr40440XFF4834R_chr40440conserved hypothetical protein

XFF4834R_chr_4675416_4676516_r2_XFF4834R-XFF4834R_chr40440 XFF4834R_chr40440
XFF4834R_chr40430
XFF4834R_chr40430
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr40450
XFF4834R_chr40450
ID XFF4834R_chr_4675416_4676516_r2_XFF4834R-XFF4834R_chr40440
AC XFF4834R_chr40440
LT XFF4834R_chr40440
OR XFF4834R_chr from 4675416 to 4676516 on strand -
DE conserved hypothetical protein
IP Glycerophosphoryl diester phosphodiesterase; PLC-like phosphodiesterase, TIM beta/alpha-barrel domain
CL 10.2 Conserved hypothetical protein
EC
GO InterPro
Biological Process: lipid metabolic process (GO:0006629)
Biological Process: glycerol metabolic process (GO:0006071)
Molecular Function: phosphoric diester hydrolase activity (GO:0008081)
Molecular Function: glycerophosphodiester phosphodiesterase activity (GO:0008889)

Curated
PM
AN
CC COG: [C] Energy production and conversion;
CC MODEL: XFF4834R
CC STATUS: validated by jacques (20110713)
MW 39652.5 Da
SQ 366 aa
 
........10........20........30........40........50
| | | | |
MTTSCEIHTLARACRRLGTIALFAALPQWAMAACGDSGATKMNAILFNGA
DKTTVLAHRGLWGKYAGIADLPENSRGALQAANDQCMDGVELDVKLTSDG
VPVLLHDYNLGRTTTVWQQHPGVKYDPITNQGVNPSVLVTPSSQVSALFL
LSPDRTTITGYHVPRVDDVFAYYKQHNLRTPMVFDIKDAATVRAVRKAAE
GAFGVASGSYVAAKVNATLYTSRDAYRADGSGMVGIPVFTTNMLGKINVR
QTISAWMNDGQQTMEINVKQLGGLLQSDADFIRERGYRVGVFQAIPDGPY
AGKFYQNSGACCNALSDLYFSYSGGRDTADNRGNLDFIVRDEVFGLITTD
DPKAAIAYLRARGKHE
XFF4834R

XFF4834R_chr00460 lcl|XFF4834R_chr00460157_0059301_f1_XFF4834R-XFF4834R_chr00460

55

112

S=149 I=48 E=1.88346e-11

XFF4834R

XFF4834R_chr33990 lcl|XFF4834R_chr36830635_3921582_r1_XFF4834R-XFF4834R_chr33990

37

114

S=100 I=36 E=1.40549e-05

XFF4834R

XFF4834R_chr00460 lcl|XFF4834R_chr00460157_0059301_f1_XFF4834R-XFF4834R_chr00460

55

112

S=149 I=48 E=1.88346e-11

XFF4834R

XFF4834R_chr33990 lcl|XFF4834R_chr36830635_3921582_r1_XFF4834R-XFF4834R_chr33990

37

114

S=100 I=36 E=1.40549e-05

X.species

NP_644474.1 lcl|XAC4175-XAC4175

1

366

S=1762 I=95 E=0

hypothetical protein

X.species

NP_639395.1 lcl|XCC4056

1

366

S=1652 I=84 E=0

hypothetical protein

X.species

lcl|XALc_0096

10

366

S=1339 I=69 E=4.06419e-155

hypothetical protein

X.species

YP_361783.1 lcl|avrBs2-XCV0052

55

112

S=152 I=50 E=2.70267e-11

avirulence protein AvrBs2

X.species

NP_635447.1 lcl|avrBs2-XCC0052

55

114

S=151 I=48 E=4.1072e-11

avirulence protein

X.species

NP_640432.1 lcl|avrBs2-XAC0076

55

112

S=148 I=48 E=8.46888e-11

avirulence protein

pubmed

55

112

S=152 I=50 E=1.0382e-09

Avirulence protein AvrBs2

Pubmed 8755898

 

prodomImg

pubmed

51

114

S=138 I=47 E=5.58101e-08

Glycerophosphodiester phosphodiesterase 1 EC=3.1.4.44 ; Cytoplasm Glycoprotein Hydrolase Magnesium Membrane Metal-binding Transmembrane

Pubmed 10760272

 

prodomImg

pubmed

51

114

S=138 I=47 E=6.08945e-08

Glycerophosphodiester phosphodiesterase 1 EC=3.1.4.44 ; Cytoplasm Glycoprotein Hydrolase Magnesium Membrane Metal-binding Transmembrane

Pubmed 10760272

 

prodomImg

pubmed

51

114

S=135 I=45 E=1.08265e-07

Glycerophosphodiester phosphodiesterase 1 EC=3.1.4.44 ; Cytoplasm Glycoprotein Hydrolase Magnesium Membrane Metal-binding Polymorphism Transmemb

Pubmed 10760272,10493829

 

prodomImg

pubmed

53

114

S=126 I=45 E=1.36886e-06

Glycerophosphodiester phosphodiesterase

Pubmed 15168170

 

prodomImg

pubmed

72

126

S=125 I=47 E=1.8412e-06

Glycerophosphodiester phosphodiesterase 2

Pubmed 16195461

 

prodomImg

pubmed

52

114

S=124 I=46 E=2.70214e-06

Glycerophosphoryldiester phosphodiesterase

Pubmed 15357724

 

prodomImg

pubmed

52

114

S=121 I=44 E=6.40578e-06

Glycerophosphoryl diester phosphodiesterase

Pubmed 17322329

 

prodomImg

pubmed

53

114

S=115 I=44 E=3.15866e-05

Glycerophosphodiester phosphodiesterase

Pubmed 15168170

 

prodomImg

sp

51

114

S=138 I=47 E=3.84024e-08

Glycerophosphodiester phosphodiesterase 1 EC=3.1.4.44 ; Cytoplasm Glycoprotein Hydrolase Magnesium Membrane Metal-binding Transmembrane

 

prodomImg

sp

51

114

S=138 I=47 E=4.19009e-08

Glycerophosphodiester phosphodiesterase 1 EC=3.1.4.44 ; Cytoplasm Glycoprotein Hydrolase Magnesium Membrane Metal-binding Transmembrane

 

prodomImg

sp

51

114

S=135 I=45 E=7.4496e-08

Glycerophosphodiester phosphodiesterase 1 EC=3.1.4.44 ; Cytoplasm Glycoprotein Hydrolase Magnesium Membrane Metal-binding Polymorphism Transmemb

 

prodomImg

sp

51

114

S=131 I=44 E=2.25434e-07

Glycerophosphodiester phosphodiesterase 1 EC=3.1.4.44 ; Cytoplasm Glycoprotein Hydrolase Magnesium Membrane Metal-binding Transmembrane

 

prodomImg

sp

51

116

S=130 I=45 E=3.48613e-07

Uncharacterized protein MG293 ; Hydrolase

 

prodomImg

PD464727

115

366

S=1235 I=91 E=3.9331e-142

PD600549

1

50

S=174 I=66 E=1.51586e-13

PD542577

52

115

S=108 I=45 E=1.29833e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one hTPAtSo7)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

9 hits
swiss-prot

Swiss-Prot ncbi-blastp

7 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

2 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

0 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB5PJJMW/XFF4834R_chr40440.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB5PJJMW/XFF4834R_chr40440.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB5PJJMW/XFF4834R_chr40440.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB5PJJMW/XFF4834R_chr40440.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.