Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr39770XFF4834R_chr_4579220_4579714_f2_XFF4834R-XFF4834R_chr39770XFF4834R_chr39770hypothetical protein

XFF4834R_chr_4579220_4579714_f2_XFF4834R-XFF4834R_chr39770 XFF4834R_chr39770
XFF4834R_chr39760
XFF4834R_chr39760
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr_4235
XFF4834R_chr_4235
ID XFF4834R_chr_4579220_4579714_f2_XFF4834R-XFF4834R_chr39770
AC XFF4834R_chr39770
LT XFF4834R_chr39770
OR XFF4834R_chr from 4579148 to 4579714 on strand +
DE hypothetical protein
IP
CL 10.2 Conserved hypothetical protein
EC
GO InterPro


Curated
PM
AN orthologous to orf 13 of the pig cluster: XOO4076 and XCC4018
CC COG: [S] Function unknown;
CC MODEL: XFF4834R
CC STATUS: curated by jacques (20100820)
MW 19806.2 Da
SQ 188 aa
 
........10........20........30........40........50
| | | | |
MSTVQPASARQRGGFVTPLAWVSLLLGVVSVLANLVQIAMIALTPGAASL
GLPAGITLPHSWQWLIDHALSLSVAGAVLSAAFCWLSWALLQRREWARLG
FVAVLLGTGVLNFGGLALIGPLFDGVQTLLPADVLQSPEWPQMQARLQAT
QQMALVLTGLGALAIGCVHAVLAWRLCTPAVRAEFSQP
X.species

NP_644407.1 lcl|XAC4108-XAC4108

1

188

S=737 I=80 E=1.6829e-82

hypothetical protein

X.species

YP_365928.1 lcl|XCV4197

1

187

S=681 I=76 E=8.1141e-76

hypothetical protein

X.species

NP_639357.1 lcl|XCC4018

8

186

S=489 I=58 E=1.47822e-52

hypothetical protein

X.species

lcl|XALc_0121

87

187

S=153 I=40 E=7.82712e-12

hypothetical protein

pubmed

1

187

S=655 I=72 E=5.30408e-71

Putative uncharacterized protein

Pubmed 12057948

 

prodomImg

Iprscan [seg]

19

36

-

Iprscan [seg]

69

82

-

Iprscan [SignalP-NN(euk)]

1

33

-

Iprscan [tmhmm]

21

43

-

Iprscan [tmhmm]

69

91

-

Iprscan [tmhmm]

98

120

-

Iprscan [tmhmm]

152

174

-

PD307157

6

185

S=520 I=60 E=1.58935e-55

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one zu2A7Ax4)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

1 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

7 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBM3qMno/XFF4834R_chr39770.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBM3qMno/XFF4834R_chr39770.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBM3qMno/XFF4834R_chr39770.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBM3qMno/XFF4834R_chr39770.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.