Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr39730XFF4834R_chr42960526_4576877_f3_XFF4834R-XFF4834R_chr39730XFF4834R_chr39730putative dipeptidyl peptidase, xanthomonadin biosynthesis

XFF4834R_chr42960526_4576877_f3_XFF4834R-XFF4834R_chr39730 XFF4834R_chr39730
XFF4834R_chr_4230
XFF4834R_chr_4230
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr_4599
XFF4834R_chr_4599
ID XFF4834R_chr42960526_4576877_f3_XFF4834R-XFF4834R_chr39730
AC XFF4834R_chr39730
LT XFF4834R_chr39730
OR XFF4834R_chr from 4574526 to 4576877 on strand +
DE putative dipeptidyl peptidase, xanthomonadin biosynthesis
IP Peptidase S9B, dipeptidylpeptidase IV N-terminal; Six-bladed beta-propeller, TolB-like
CL 1.2.3 Proteins/peptides/glycopeptides GO:0006508 GO:0009050
EC
GO InterPro
Biological Process: proteolysis (GO:0006508)
Cellular Component: membrane (GO:0016020)

Curated
PM
AN orthologous to orf 12 of the pig cluster: XOO4075 and XCC4016
CC COG: [E] Amino acid transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by jacques (20101118)
MW 87562.3 Da
SQ 783 aa
 
........10........20........30........40........50
| | | | |
MTLLLVATAAHAQSASPLTIEQAMADPDWIGPSVDQAWWQWDGKQVQYLL
KRDGSPVRDTYRQGTGGGTAERVADTARAGLDAANPSYDATRQRMLFARN
GDIFLRDLRTGTLTQLTRSNEIESRPQFASDGGAIWRAGNNWYHWRADGG
TAQVAVVKAERDPNAAPKADVLREQQLATLATLRRDKEQRDALRTQEDAW
RRADATRAAAPVYLGDEVEIVDSALSPDGRHLLVVTQAKSADEGQAGKMP
KYVTESGYEEFQEVRTRVGRNAPAAHALWLVDVGAGTAKTLSFDPLPGIS
TDPLAALRKTAKRDALKGNRAVRVESDGDGSGPAVHWSDDGRNVAVEIRA
VDNKDRWIASVDLDNARLQPRHRLSDSAWINWDFNDFGWLPDNRTLWLLS
EESGYSQLYTVEGDGKPRQRTRGKWEVSMPVPSADGSGMFFLCNQKWPGD
YEVCKLDLRNDQLTEITALNGVEGYSLSPNGQQLLVRYSGSYLPTQLAVV
PAAGGQATVLTDTRTPAFKAQPWIAPQYVQVPSKHGAGTVWGKYYGPKTP
EPGKQYPIVMFVHGAGYLQNVSERYTPYFREQMFHNLLVQQGYIVLDLDY
RASEGYGRDWRTAIYRNMGHPELEDYLDGLDWLVATKQGDRARVGIYGGS
YGGFMTYMALFRSPGTFKAGAALRPVGDWMQYNHEYTSNILNTPELDPEA
YKTSSPINYAQGLRDHLLIAHGMIDDNVFFKDSVDMTQKLMELHKDNWQV
APYPLERHGFTRADSWLDEYKRILKLFNEQVKP
XFF4834R

XFF4834R_chr39110 lcl|XFF4834R_chr42280649_4505895_r1_XFF4834R-XFF4834R_chr39110

385

771

S=417 I=30 E=1.22369e-43

XFF4834R

XFF4834R_chr06030 lcl|XFF4834R_chr06210169_0678496_r3_XFF4834R-XFF4834R_chr06030

335

760

S=234 I=23 E=2.21182e-21

XFF4834R

XFF4834R_chr25630 lcl|XFF4834R_chr28140564_2970903_r1_XFF4834R-XFF4834R_chr25630

335

772

S=211 I=23 E=1.15734e-18

XFF4834R

XFF4834R_chr02350 lcl|XFF4834R_chr02470019_0278103_r1_XFF4834R-XFF4834R_chr02350

557

765

S=161 I=27 E=1.34723e-12

XFF4834R

XFF4834R_chr33360 lcl|XFF4834R_chr36080480_3842600_r2_XFF4834R-XFF4834R_chr33360

415

775

S=157 I=25 E=4.37139e-12

XFF4834R

XFF4834R_chr25500 lcl|XFF4834R_chr27940691_2949024_r1_XFF4834R-XFF4834R_chr25500

390

746

S=156 I=25 E=6.19554e-12

XFF4834R

XFF4834R_chr08110 lcl|XFF4834R_chr_0937630_0940164_f1_XFF4834R-XFF4834R_chr08110

623

728

S=110 I=33 E=2.2618e-06

XFF4834R

XFF4834R_chr14870 lcl|tolB-XFF4834R_chr14870

39

170

S=108 I=31 E=4.27435e-06

periplasmic protein

XFF4834R

XFF4834R_chr06380 lcl|XFF4834R_chr06620622_0727715_f3_XFF4834R-XFF4834R_chr06380

589

746

S=100 I=25 E=3.28785e-05

XFF4834R

XFF4834R_chr23450 lcl|XFF4834R_chr25620609_2714735_r2_XFF4834R-XFF4834R_chr23450

586

680

S=96 I=32 E=9.44233e-05

X.species

NP_644405.1 lcl|XAC4106-XAC4106

17

783

S=3965 I=97 E=0

dipeptidyl peptidase

X.species

YP_365925.1 lcl|XCV4194

17

783

S=3917 I=95 E=0

aminopeptidase precursor

X.species

NP_639355.1 lcl|XCC4016

17

783

S=3723 I=91 E=0

dipeptidyl-peptidase

X.species

lcl|XALc_0122

1

782

S=3207 I=75 E=0

putative dipeptidyl-peptidase iv protein

X.species

lcl|XALc_3000

335

783

S=458 I=29 E=6.39664e-48

putative dipeptidyl peptidase iv precursor protein

X.species

NP_644345.1 lcl|XAC4046-XAC4046

385

771

S=436 I=31 E=2.64501e-45

dipeptidyl peptidase IV

X.species

NP_639300.1 lcl|XCC3961

335

783

S=424 I=28 E=8.13811e-44

dipeptidyl peptidase IV

X.species

YP_365867.1 lcl|XCV4136

385

783

S=414 I=29 E=1.15245e-42

putative dipeptidyl peptidase IV

X.species

NP_640944.2 lcl|XAC0591-XAC0591

386

760

S=235 I=24 E=5.43971e-21

dipeptidyl peptidase IV

X.species

NP_638894.2 lcl|XCC3548

335

760

S=230 I=25 E=2.13824e-20

dipeptidyl peptidase IV

pubmed

17

783

S=3849 I=94 E=0

Putative dipeptidyl peptidase

Pubmed 12057948

 

prodomImg

pubmed

335

783

S=448 I=27 E=3.97233e-45

Dipeptidyl peptidase IV

Pubmed 9010758

 

prodomImg

pubmed

358

758

S=440 I=28 E=4.03883e-44

Dipeptidyl peptidase IV

Pubmed 7793970

 

prodomImg

pubmed

335

783

S=435 I=28 E=1.45503e-43

Dipeptidyl aminopeptidase IV

Pubmed 15866709

 

prodomImg

pubmed

317

781

S=356 I=26 E=5.72632e-34

DPP IV Dipeptidyl aminopeptidase IV

Pubmed 10639438

 

prodomImg

sp

337

781

S=352 I=25 E=1.02657e-33

Prolyl tripeptidyl peptidase EC=3.4.14.12 ; Aminopeptidase Hydrolase Protease Serine Signal

 

prodomImg

sp

337

781

S=352 I=25 E=1.11037e-33

Prolyl tripeptidyl peptidase EC=3.4.14.12 ; Aminopeptidase Hydrolase Protease Serine Signal

 

prodomImg

sp

462

781

S=322 I=31 E=5.7048e-30

Dipeptidyl peptidase 9 EC=3.4.14.5 ; Acetylation Alternative splicing Aminopeptidase Cytoplasm Hydrolase Protease Serine

 

prodomImg

sp

540

765

S=314 I=35 E=5.08925e-29

Dipeptidyl peptidase 9 EC=3.4.14.5 ; Acetylation Alternative splicing Aminopeptidase Cytoplasm Hydrolase Protease Serine

 

prodomImg

sp

523

765

S=295 I=32 E=1.00294e-26

Dipeptidyl peptidase 8 EC=3.4.14.5 ; Alternative splicing Aminopeptidase Cytoplasm Hydrolase Phosphoprotein Protease Serine

 

prodomImg

Iprscan IPR011042 [G3DSA:2.120.10.30]

37

240

Six-bladed beta-propeller, TolB-like

Iprscan IPR011042 [G3DSA:2.120.10.30]

277

511

Six-bladed beta-propeller, TolB-like

Iprscan [G3DSA:3.40.50.1820]

525

783

-

Iprscan [PTHR11731]

335

781

-

Iprscan [PF00326]

586

781

-

Iprscan IPR002469 [PF00930]

333

494

Peptidase S9B, dipeptidylpeptidase IV N-terminal

Iprscan [seg]

198

210

-

Iprscan [SignalP-NN(euk)]

1

17

-

PD324999

169

394

S=641 I=56 E=5.22133e-70

PDA1H3M7

19

189

S=429 I=50 E=3.19066e-44

PD435174

551

777

S=308 I=39 E=1.46295e-29

PD714710

539

590

S=294 I=100 E=5.64643e-28

PD253379

726

783

S=283 I=83 E=1.40927e-26

PDA1F263

470

538

S=220 I=66 E=5.80304e-19

PD381984

554

655

S=126 I=33 E=1.31639e-07

PDA2A5K6

540

586

S=115 I=46 E=2.85772e-06

PDA8I0C2

1

150

S=110 I=25 E=1.37275e-05

PDA3K4S5

539

657

S=109 I=26 E=1.66301e-05

Iprscan [SSF53474]

497

782

-

Iprscan [SSF82171]

14

524

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one QGMJVAXc)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

78 hits
swiss-prot

Swiss-Prot ncbi-blastp

75 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

10 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

10 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBkRb6_C/XFF4834R_chr39730.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBkRb6_C/XFF4834R_chr39730.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBkRb6_C/XFF4834R_chr39730.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBkRb6_C/XFF4834R_chr39730.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.