Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr39690xanB1XFF4834R_chr39690putative oxidoreductase, xanthomonadin biosynthesis

xanB1 XFF4834R_chr39690
XFF4834R_chr39680
XFF4834R_chr39680
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr39700
XFF4834R_chr39700
ID xanB1
AC XFF4834R_chr39690
LT XFF4834R_chr39690
OR XFF4834R_chr from 4569620 to 4571005 on strand +
DE putative oxidoreductase, xanthomonadin biosynthesis
IP Fumarate reductase/succinate dehydrogenase flavoprotein, N-terminal
CL 1.4.3 Electron carrier GO:0009055
EC
GO InterPro
Molecular Function: electron carrier activity (GO:0009055)
Molecular Function: oxidoreductase activity (GO:0016491)

Curated
PM
AN orthologous to orf11 of the pig cluster: XOO4071 and XCC4013 xanB1 de Poplawsky et al 2005 MPP 6 653-657
CC COG: [C] Energy production and conversion;
CC MODEL: XFF4834R
CC STATUS: curated by jacques (20101121)
MW 51205.2 Da
SQ 461 aa
 
........10........20........30........40........50
| | | | |
MTSTAVRLTPTAMPAAGPAPGPECPDVLIVGGGPAGCTAAIALAELGWSV
TLLEKAQHPRFHIGESLLPMNMPILERLGVLEDVRAIGVLKRGADFPNDS
GGYNTFRFSHALDAKADFAFQVPRAQFDHVLFQRARAMGVDAREQVCVEQ
VAFDGEHPVLQARTTDGGVQQFRPRYLLDASGRDTFLGNRLKLKRANATH
QSAALFSHFRGVARRPGEDAGNISIYRHAHGWMWLIPLPEDIMSVGAVCY
PDYMKTRQGDSEGFLMRTLALNAELNARMLGAERVAPVHATGNYAYECTR
MAGPRWLMLGDAYTFVDPMFSSGVFLAMHGAERGAAMVDAALRAPQSEAK
LQRALQRELTRGVDEFKWFIYRFTSPTMRALFAQPQNTWQVEQAVVAMLA
GDVFDAPKVRIRLRAFRALYALTTLSMMPRAWQSWRHRRRQAKLGFDGDT
LQRDTQQRDAQ
XFF4834R

XFF4834R_chr39570 lcl|XFF4834R_chr42840190_4560812_f3_XFF4834R-XFF4834R_chr39570

26

328

S=206 I=28 E=3.17558e-18

XFF4834R

XFF4834R_chr39570 lcl|XFF4834R_chr42840190_4560812_f3_XFF4834R-XFF4834R_chr39570

26

328

S=206 I=28 E=3.17558e-18

X.species

NP_644401.1 lcl|XAC4102-XAC4102

23

460

S=2302 I=99 E=0

hydroxylase

X.species

YP_365921.1 lcl|XCV4190

1

460

S=2295 I=94 E=0

putative oxidoreductase

X.species

NP_639352.1 lcl|XCC4013

23

454

S=1960 I=86 E=0

reductase/halogenase

X.species

lcl|XALc_0127

50

454

S=1559 I=75 E=0

putative oxidoreductase protein

X.species

YP_365906.1 lcl|XCV4175

26

328

S=211 I=28 E=2.62443e-18

putative halogenase

X.species

lcl|XALc_0139

24

328

S=210 I=29 E=3.6553e-18

putative halogenase protein

X.species

NP_644388.1 lcl|XAC4089-XAC4089

26

328

S=205 I=28 E=1.39973e-17

halogenase

X.species

NP_639340.1 lcl|XCC4001

26

328

S=178 I=26 E=2.98114e-14

halogenase

X.species

lcl|XALc_1939

49

372

S=136 I=25 E=2.79295e-09

putative oxidoreductase protein

X.species

NP_636923.1 lcl|XCC1552

29

340

S=102 I=24 E=4.82128e-05

kynurenine 3-monooxygenase

pubmed

1

383

S=1764 I=89 E=0

Putative halogenase

Pubmed 12057948

 

prodomImg

pubmed

26

406

S=519 I=35 E=4.82643e-54

Halogenase

Pubmed 12060743

 

prodomImg

pubmed

26

419

S=475 I=33 E=1.14938e-48

ChlB4

Pubmed 16793515

 

prodomImg

pubmed

26

356

S=459 I=34 E=9.14721e-47

CalO3

Pubmed 12183629

 

prodomImg

pubmed

26

401

S=451 I=32 E=8.30375e-46

Putative halogenase

Pubmed 12480894

 

prodomImg

pubmed

34

405

S=443 I=32 E=8.36947e-45

Halogenase

Pubmed 17158935

 

prodomImg

pubmed

27

357

S=443 I=34 E=8.81896e-45

Tryptophan halogenase

Pubmed 16793524

 

prodomImg

pubmed

26

373

S=430 I=34 E=2.64335e-43

Halogenase

Pubmed 15113000

 

prodomImg

pubmed

26

373

S=430 I=34 E=2.66649e-43

Halogenase

Pubmed 14702401

 

prodomImg

pubmed

26

373

S=425 I=35 E=1.07592e-42

Non-heme halogenase

Pubmed 11447274

 

prodomImg

sp

26

373

S=147 I=25 E=3.71015e-09

Conditioned medium factor receptor 1 ; Membrane Transmembrane

 

prodomImg

PD603424

358

439

S=317 I=65 E=7.81045e-31

PDA1I963

58

105

S=202 I=73 E=7.07512e-17

PDA1K5K2

184

228

S=178 I=69 E=5.20137e-14

PDA8H6D3

439

460

S=108 I=100 E=1.59102e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one KxE4r8Ia)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

45 hits
swiss-prot

Swiss-Prot ncbi-blastp

1 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

0 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBx8Rn_O/XFF4834R_chr39690.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBx8Rn_O/XFF4834R_chr39690.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBx8Rn_O/XFF4834R_chr39690.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBx8Rn_O/XFF4834R_chr39690.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.