Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr39680XFF4834R_chr42920087_4569356_r2_XFF4834R-XFF4834R_chr39680XFF4834R_chr39680putative acyl carrier protein, xanthomonadin biosynthesis

XFF4834R_chr42920087_4569356_r2_XFF4834R-XFF4834R_chr39680 XFF4834R_chr39680
XFF4834R_chr39670
XFF4834R_chr39670
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr39690
XFF4834R_chr39690
ID XFF4834R_chr42920087_4569356_r2_XFF4834R-XFF4834R_chr39680
AC XFF4834R_chr39680
LT XFF4834R_chr39680
OR XFF4834R_chr from 4569087 to 4569434 on strand -
DE putative acyl carrier protein, xanthomonadin biosynthesis
IP Acyl carrier protein-like
CL 1.6.15.4 Acyl carrier protein GO:0042967
EC
GO InterPro
Molecular Function: acyl carrier activity (GO:0000036)
Molecular Function: cofactor binding (GO:0048037)

Curated
PM
AN orthologous to orf 10 of the pig cluster: XOO4070 and XCC4012. orf10 is homologous to acyl carrier proteins (ACPs) from various prokaryotic and eukaryotic organisms. The ACPs are important constituents of PKS-FAS biosynthetic pathways. A conserved phosphopantethein attachment domain (pfam00550) has been identified in this ORF (Fig. ​(Fig.2A).2A). Phosphopantethein is the prosthetic group that attaches to a conserved serine residue (Fig. ​(Fig.2A)2A) in ACPs and serves as a swinging arm for the attachment of activated fatty acyl groups. The homology of the orf10 product to ACPs is significant because, to our knowledge, it is the first genetic evidence to indicate that PKS-FAS biosynthetic pathways may be involved in xanthomonadin production.
CC COG: [IQ] Lipid transport and metabolism;Secondary metabolites biosynthesis, transport and catabolism;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120309)
MW 12741.2 Da
SQ 115 aa
 
........10........20........30........40........50
| | | | |
MPADGRPRCSCLFSLLLPDPDLWKSWMSSQTAAERELAELLVESLNLEDV
QPADIDPEAPLFNTGLGLDSIDALELALAISKRYGFQLRSDNDENRRIFA
SLRALSAHVQANKTV
X.species

YP_365920.1 XCV4189

1

115

S=526 I=89.57 E=2.60467e-57

acyl carrier protein

xanc5

X.species

NP_644400.2 acpC-XAC4101

27

115

S=395 I=88.76 E=1.61907e-41

acyl carrier protein

xanac

X.species

NP_639351.2 acpC-XCC4012

27

115

S=387 I=86.52 E=1.46977e-40

acyl carrier protein

xancp

X.species

XALc_0128 XALc_0128

27

114

S=361 I=84.09 E=2.18949e-37

putative acyl carrier protein

xanal

pubmed

3

115

S=487 I=84.96 E=3.94289e-51

Putative acyl carrier protein

Pubmed 12057948

 

prodomImg

pubmed

42

113

S=179 I=48.61 E=8.09161e-14

Putative uncharacterized protein

Pubmed 15292145

 

prodomImg

pubmed

42

112

S=107 I=42.25 E=3.99807e-05

Acyl carrier protein homolog AcpC

Pubmed 10322024,10913694

 

prodomImg

Iprscan IPR009081 [G3DSA:1.10.1200.10]

30

112

Acyl carrier protein-like

Iprscan IPR006163 [PF00550]

36

108

Phosphopantetheine-binding

Iprscan IPR009081 [PS50075]

33

107

Acyl carrier protein-like

Iprscan [seg]

32

41

-

PD894381

1

31

S=142 I=87.1 E=9.67366e-10

Iprscan IPR009081 [SSF47336]

30

111

Acyl carrier protein-like

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one rMV0sG8P)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

3 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

5 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBNxNrLK/XFF4834R_chr39680.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBNxNrLK/XFF4834R_chr39680.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBNxNrLK/XFF4834R_chr39680.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBNxNrLK/XFF4834R_chr39680.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.