Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr39670XFF4834R_chr42910366_4569022_r3_XFF4834R-XFF4834R_chr39670XFF4834R_chr39670hypothetical secreted protein, xanthomonadin biosynthesis

XFF4834R_chr42910366_4569022_r3_XFF4834R-XFF4834R_chr39670 XFF4834R_chr39670
XFF4834R_chr39660
XFF4834R_chr39660
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr39680
XFF4834R_chr39680
ID XFF4834R_chr42910366_4569022_r3_XFF4834R-XFF4834R_chr39670
AC XFF4834R_chr39670
LT XFF4834R_chr39670
OR XFF4834R_chr from 4568366 to 4569085 on strand -
DE hypothetical secreted protein, xanthomonadin biosynthesis
IP
CL 10.2 Conserved hypothetical protein
EC
GO InterPro


Curated
PM
AN orthologous to orf 9 of the pig cluster: XOO4069 and XCC4011
CC COG: [S] Function unknown;
CC MODEL: XFF4834R
CC STATUS: curated by jacques (20101118)
MW 26144.7 Da
SQ 239 aa
 
........10........20........30........40........50
| | | | |
LPTAPSPDAPAWVLGLGVLLAVAYSPLAHWANASHRPELAVIAGGLLVLM
VLIEPMVARRPWAWALALLLLAGLGALWHSPYAMLVLAAPPVVFTGWVAW
FFGRSLRAGRTPLITRIVEGLYGQAGMPITPEQRRYTRRLTLAWALLLCG
LTLANLVLGLCAEPSGVLAQLGHASPLPISDARASLFANLLAYGVIGGFF
VGEYLLRGRWFPQRPYRNLPDFLRQMARLGPDFWRDLLR
X.species

NP_644399.1 XAC4100-XAC4100

1

239

S=908 I=78 E=4.12616e-103

ketosynthase

X.species

YP_365919.1 XCV4188

1

239

S=904 I=78 E=1.24862e-102

putative xanthomonadin biosynthesis membrane protein

X.species

NP_639350.1 XCC4011

24

239

S=764 I=72 E=9.98597e-86

ketosynthase

X.species

XALc_0130 XALc_0130

163

239

S=305 I=77 E=5.13143e-30

hypothetical protein (fragment)

X.species

XALc_0129 XALc_0129

79

139

S=199 I=74 E=3.61285e-17

hypothetical protein (fragment)

pubmed

24

239

S=813 I=77 E=5.42866e-90

Putative uncharacterized protein

Pubmed 12057948

 

prodomImg

Iprscan [seg]

13

23

-

Iprscan [seg]

62

78

-

Iprscan [seg]

140

162

-

Iprscan [SignalP-NN(euk)]

1

33

-

Iprscan [tmhmm]

10

32

-

Iprscan [tmhmm]

39

58

-

Iprscan [tmhmm]

78

100

-

Iprscan [tmhmm]

140

162

-

Iprscan [tmhmm]

184

206

-

PD314986

163

239

S=365 I=91 E=8.37333e-37

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one hulmdS7y)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

1 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

9 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBc4RRVk/XFF4834R_chr39670.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBc4RRVk/XFF4834R_chr39670.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBc4RRVk/XFF4834R_chr39670.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBc4RRVk/XFF4834R_chr39670.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.