Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr39660XFF4834R_chr42900563_4568312_r2_XFF4834R-XFF4834R_chr39660XFF4834R_chr39660putative acyltransferase, xanthomonadin biosynthesis

XFF4834R_chr42900563_4568312_r2_XFF4834R-XFF4834R_chr39660 XFF4834R_chr39660
XFF4834R_chr39650
XFF4834R_chr39650
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr39670
XFF4834R_chr39670
ID XFF4834R_chr42900563_4568312_r2_XFF4834R-XFF4834R_chr39660
AC XFF4834R_chr39660
LT XFF4834R_chr39660
OR XFF4834R_chr from 4567563 to 4568312 on strand -
DE putative acyltransferase, xanthomonadin biosynthesis
IP Phospholipid/glycerol acyltransferase
CL 1.6.1.2 Phospholipid biosynthesis I
EC
GO InterPro
Biological Process: metabolic process (GO:0008152)
Biological Process: phospholipid biosynthetic process (GO:0008654)
Cellular Component: membrane (GO:0016020)
Molecular Function: 1-acylglycerol-3-phosphate O-acyltransferase activity (GO:0003841)
Molecular Function: acyltransferase activity (GO:0008415)

Curated
PM
AN orthologous to orf 8 of the pig cluster: XOO4068 and XCC4010
CC COG: [I] Lipid transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by jacques (20101118)
MW 27368.1 Da
SQ 249 aa
 
........10........20........30........40........50
| | | | |
MPLARMPSRLAWAVFNLLQLAFTLAFTAGGIVYALVVLAITRDADRLLRM
GSWMWSPVLFRGAGATVIVEGRERVDWSKNYLFVSNHQSIIDICALFHAL
PVPLRFLLKQEMRKVPFVNWYAHAAGMLFLDRDSRRAGALVRRQAAALLR
EGKQLCLFPEGTRSRTGALLPFKAGLLQAAIDAGVQVVPVALDGCGKVLP
VDGLFRVRPGIIRVRIGAPIAVTGPDAPDRQQLTEQAHKAVAAMLQPRI
XFF4834R

XFF4834R_chr01640 lcl|XFF4834R_chr01790147_0201950_f3_XFF4834R-XFF4834R_chr01640

82

192

S=153 I=38 E=3.73427e-12

XFF4834R

XFF4834R_chr05040 lcl|lplT-XFF4834R_chr05040

45

194

S=143 I=26 E=5.8714e-11

predicted inner membrane protein

XFF4834R

XFF4834R_chr05180 lcl|XFF4834R_chr05310797_0585429_f1_XFF4834R-XFF4834R_chr05180

78

200

S=113 I=26 E=2.69334e-07

X.species

NP_644398.1 lcl|plsC-XAC4099

1

249

S=1016 I=81 E=3.40699e-116

acyltransferase

X.species

YP_365918.1 lcl|XCV4187

1

249

S=1008 I=80 E=3.52496e-115

putative xanthomonadin biosynthesis ayltransferase

X.species

NP_639349.1 lcl|plsC-XCC4010

1

249

S=969 I=77 E=1.76282e-110

acyltransferase

X.species

lcl|XALc_0131

4

249

S=613 I=56 E=2.13334e-67

putative xanthomonadin biosynthesis acyltransferase protein

X.species

YP_361911.1 lcl|XCV0180

31

192

S=153 I=34 E=1.18574e-11

putative 1-acyl-sn-glycerol-3-phosphate acyltransferase

X.species

NP_640553.1 lcl|XAC0197-XAC0197

82

192

S=153 I=38 E=1.46172e-11

acetyltransferase

X.species

NP_635574.1 lcl|XCC0179

82

192

S=152 I=38 E=1.58104e-11

acetyltransferase

X.species

YP_362272.1 lcl|XCV0541

47

194

S=144 I=27 E=1.4992e-10

putative fatty acid permease / acyltransferase fusion protein

X.species

lcl|XALc_0304

31

192

S=142 I=31 E=2.46429e-10

putative fatty acid permease / acyltransferase fusion protein

X.species

NP_640860.1 lcl|aas-XAC0507

47

194

S=142 I=27 E=2.98535e-10

2-acylglycerophosphoethanolamine acyltransferase

X.species

NP_635885.1 lcl|aas-XCC0493

45

194

S=142 I=27 E=3.14567e-10

2-acylglycerophosphoethanolamineacyltransferase

X.species

lcl|XALc_3098

82

192

S=132 I=34 E=5.12148e-09

putative acyltransferase protein

X.species

NP_635897.1 lcl|XCC0505

78

200

S=114 I=26 E=7.83806e-07

acyltransferase

X.species

YP_362285.1 lcl|XCV0554

78

200

S=113 I=26 E=9.66239e-07

putative acyltransferase

X.species

NP_640873.1 lcl|XAC0520-XAC0520

78

200

S=111 I=26 E=1.70297e-06

acyltransferase

pubmed

1

249

S=961 I=76 E=6.89503e-108

Putative acetyl transferase

Pubmed 12057948

 

prodomImg

pubmed

63

205

S=193 I=28 E=8.00307e-15

1-acyl-sn-glycerol-3-phosphate acyltransferase EC=2.3.1.51 ; Phospholipid biosynthesis

Pubmed 7812434

 

prodomImg

pubmed

69

201

S=183 I=34 E=1.3259e-13

1-acyl-sn-glycerol-3-phosphate acyltransferase 1, chloroplastic EC=2.3.1.51 ; Membrane Phospholipid biosynthesis Plastid Transit peptide Transmembrane

Pubmed 10398728

 

prodomImg

pubmed

64

205

S=178 I=34 E=4.33986e-13

Probable 1-acyl-sn-glycerol-3-phosphate acyltransferase EC=2.3.1.51 ; Membrane Phospholipid biosynthesis Transmembrane

Pubmed 8408076

 

prodomImg

pubmed

71

192

S=167 I=34 E=9.09842e-12

1-acyl-sn-glycerol-3-phosphate acyltransferase EC=2.3.1.51 ; Cell inner membrane Phospholipid biosynthesis

Pubmed 8748025

 

prodomImg

sp

63

205

S=193 I=28 E=5.45956e-15

1-acyl-sn-glycerol-3-phosphate acyltransferase EC=2.3.1.51 ; Phospholipid biosynthesis

 

prodomImg

sp

69

201

S=183 I=34 E=9.04507e-14

1-acyl-sn-glycerol-3-phosphate acyltransferase 1, chloroplastic EC=2.3.1.51 ; Membrane Phospholipid biosynthesis Plastid Transit peptide Transmembrane

 

prodomImg

sp

69

201

S=183 I=34 E=9.36608e-14

1-acyl-sn-glycerol-3-phosphate acyltransferase 1, chloroplastic EC=2.3.1.51 ; Alternative splicing Developmental protein Membrane Phospholipid

 

prodomImg

sp

64

205

S=178 I=34 E=2.96058e-13

Probable 1-acyl-sn-glycerol-3-phosphate acyltransferase EC=2.3.1.51 ; Membrane Phospholipid biosynthesis Transmembrane

 

prodomImg

sp

71

192

S=167 I=34 E=6.20679e-12

1-acyl-sn-glycerol-3-phosphate acyltransferase EC=2.3.1.51 ; Cell inner membrane Phospholipid biosynthesis

 

prodomImg

Iprscan [PTHR10434]

9

245

-

Iprscan IPR002123 [PF01553]

67

192

Phospholipid/glycerol acyltransferase

Iprscan IPR002123 [SM00563]

81

195

Phospholipid/glycerol acyltransferase

Iprscan IPR004552 [TIGR00530]

64

193

1-acyl-sn-glycerol-3-phosphate acyltransferase

Iprscan [seg]

17

28

-

Iprscan [seg]

135

150

-

Iprscan [seg]

206

221

-

Iprscan [SignalP-NN(euk)]

1

25

-

Iprscan [tmhmm]

15

37

-

PD394822

1

58

S=219 I=74 E=4.28788e-19

PD689396

193

249

S=197 I=72 E=2.3031e-16

PD462158

151

200

S=132 I=53 E=1.61418e-08

PDA910P8

86

175

S=106 I=34 E=2.4046e-05

Iprscan [SSF69593]

12

246

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one VACsLmmq)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

33 hits
swiss-prot

Swiss-Prot ncbi-blastp

26 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

3 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

10 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBjUYHLi/XFF4834R_chr39660.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBjUYHLi/XFF4834R_chr39660.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBjUYHLi/XFF4834R_chr39660.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBjUYHLi/XFF4834R_chr39660.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.