Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr39650XFF4834R_chr42900264_4567488_r1_XFF4834R-XFF4834R_chr39650XFF4834R_chr39650putative acyl carrier protein dehydratase, xanthomonadin biosynthesis

XFF4834R_chr42900264_4567488_r1_XFF4834R-XFF4834R_chr39650 XFF4834R_chr39650
XFF4834R_chr39640
XFF4834R_chr39640
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr39660
XFF4834R_chr39660
ID XFF4834R_chr42900264_4567488_r1_XFF4834R-XFF4834R_chr39650
AC XFF4834R_chr39650
LT XFF4834R_chr39650
OR XFF4834R_chr from 4567264 to 4567551 on strand -
DE putative acyl carrier protein dehydratase, xanthomonadin biosynthesis
IP Beta-hydroxyacyl-(acyl-carrier-protein) dehydratase, FabA/FabZ
CL 1.5.4 Fatty acid and phosphatidic acid GO:0006633 GO:0006654
EC
GO InterPro


Curated
PM
AN orthologous to orf 7 of the pig cluster: XOO4067 and XCC4009
CC COG: [I] Lipid transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by jacques (20101118)
MW 10233.9 Da
SQ 95 aa
 
........10........20........30........40........50
| | | | |
MDFVVPHDHPCLPGHFPGHPVVPGVVVLDHVLQAVEALHGPRAAMRLPQV
KFVQPLLPGQTASVTLEGDGPRWRFRVQRAEALLVSGELVAEAAP
Show or not Domain decomposition
 
X.species

NP_644397.1 lcl|XAC4098-XAC4098

1

95

S=352 I=78 E=1.56327e-36

dehydratase

X.species

YP_365917.1 lcl|XCV4186

1

94

S=347 I=78 E=6.70469e-36

xanthomonadine biosynthesis acyl carrier protein dehydratase

X.species

NP_639348.1 lcl|XCC4009

1

94

S=299 I=69 E=4.78978e-30

dehydratase

X.species

lcl|XALc_0132

1

93

S=245 I=59 E=1.38068e-23

putative xanthomonadin biosynthesis acyl carrier protein dehydratase

pubmed

1

94

S=327 I=72 E=7.84453e-32

Putative dehydratase

Pubmed 12057948

 

prodomImg

Iprscan [G3DSA:3.10.129.10]

5

94

-

Iprscan IPR013114 [PF07977]

6

92

Beta-hydroxyacyl-(acyl-carrier-protein) dehydratase, FabA/FabZ

Iprscan [seg]

12

32

-

Iprscan [SSF54637]

3

93

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 744PJEGk)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

1 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

4 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBRvFUYl/XFF4834R_chr39650.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBRvFUYl/XFF4834R_chr39650.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBRvFUYl/XFF4834R_chr39650.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBRvFUYl/XFF4834R_chr39650.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.