Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr39640XFF4834R_chr_4566293_4567267_r3_XFF4834R-XFF4834R_chr39640XFF4834R_chr39640hypothetical acyltransferase, xanthomonadin biosynthesis

XFF4834R_chr_4566293_4567267_r3_XFF4834R-XFF4834R_chr39640 XFF4834R_chr39640
XFF4834R_chr39630
XFF4834R_chr39630
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr39650
XFF4834R_chr39650
ID XFF4834R_chr_4566293_4567267_r3_XFF4834R-XFF4834R_chr39640
AC XFF4834R_chr39640
LT XFF4834R_chr39640
OR XFF4834R_chr from 4566293 to 4567267 on strand -
DE hypothetical acyltransferase, xanthomonadin biosynthesis
IP Predicted acyltransferase
CL 1.6 Macromolecules (cellular constituent) biosynthesis GO:0009059
EC
GO InterPro


Curated
PM
AN ortologous to orf 6 of the pig cluster: XOO4066 and XCC4008
CC COG: [R] General function prediction only;
CC MODEL: XFF4834R
CC STATUS: curated by jacques (20101118)
MW 36190.5 Da
SQ 324 aa
 
........10........20........30........40........50
| | | | |
MSKHWKQRPEGGGRFALWLIRGIARHAGRAVGRALLYPITLYFLLVRGPE
RAASRAYLARVLGRPASLRDVARHIHTFASTILDRVYMLCGQMQRFRVDI
TGLDQLHTQMDRGRGVLIFGSHLGSFDALRVLATERPDVQVKVVLDKAHN
RAMTDLLGALNPQLAANIIDAGMDATSIVMAIKEATDAGALVALLIDRPR
EGDPALPAMFLGRNAMFPTSPWLIAAALKVPVVLAFGLYHGGNHYELAFE
TFSEGLDVPRRQRAPVLAVLMRDYAARLEHYTCYAPYNWFNFYDFWNTHH
ADVPHPAVDADTAVQRRTAMRRTA
X.species

YP_365916.1 lcl|XCV4185

1

324

S=1697 I=100 E=0

xanthomonadin biosynthesis acyltransferase

X.species

NP_644396.1 lcl|XAC4097-XAC4097

1

324

S=1687 I=99 E=0

acyltransferase

X.species

NP_639347.1 lcl|XCC4008

1

324

S=1655 I=97 E=0

acyltransferase

X.species

lcl|XALc_0133

1

324

S=1326 I=80 E=1.29282e-153

putative xanthomonadin biosynthesis acyltransferase precursor protein

pubmed

1

324

S=1671 I=98 E=0

Putative acyl transferase

Pubmed 12057948

 

prodomImg

pubmed

2

297

S=339 I=31 E=2.06253e-32

Putative uncharacterized protein

Pubmed 15292145

 

prodomImg

pubmed

42

198

S=158 I=24 E=1.70095e-10

Putative uncharacterized protein

Pubmed 17586644

 

prodomImg

Iprscan IPR014548 [PIRSF028561]

1

324

Predicted acyltransferase

PDA1E9K7

137

183

S=234 I=100 E=6.84833e-21

PD930446

71

133

S=174 I=51 E=1.5587e-13

PD319838

2

66

S=173 I=60 E=1.82356e-13

PDA5S0V0

62

181

S=143 I=29 E=7.33962e-10

PDA1Q7G6

297

324

S=141 I=100 E=1.47433e-09

PD997845

12

128

S=104 I=28 E=3.70265e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one dQ89J1XM)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

3 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

1 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB9gXbIW/XFF4834R_chr39640.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB9gXbIW/XFF4834R_chr39640.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB9gXbIW/XFF4834R_chr39640.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB9gXbIW/XFF4834R_chr39640.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.