Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr39630XFF4834R_chr42890722_4566369_r1_XFF4834R-XFF4834R_chr39630XFF4834R_chr39630hypothetical secreted protein, xanthomonadin biosynthesis

XFF4834R_chr42890722_4566369_r1_XFF4834R-XFF4834R_chr39630 XFF4834R_chr39630
XFF4834R_chr39620
XFF4834R_chr39620
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr39640
XFF4834R_chr39640
ID XFF4834R_chr42890722_4566369_r1_XFF4834R-XFF4834R_chr39630
AC XFF4834R_chr39630
LT XFF4834R_chr39630
OR XFF4834R_chr from 4565722 to 4566369 on strand -
DE hypothetical secreted protein, xanthomonadin biosynthesis
IP
CL 7.5 Extracellular GO:0005576
EC
GO InterPro


Curated
PM
AN orthologous to orf5 of the pig cluster: XOO4065 and XCC4007 Prediction: Signal peptide Signal peptide probability: 0.999 Max cleavage site probability: 0.998 between pos. 22 and 23
CC COG: [K] Transcription;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120309)
MW 23413.6 Da
SQ 215 aa
 
........10........20........30........40........50
| | | | |
MPMCRTLPWMLILLFSAAPLCAAPPETLDVGRVLQRLARPAPVSTDFVEL
RGSALLKTPLRVEGHYRRPDAQTLVREVSAPYRETTTLTGDEGVLEREGK
SPRRFSLSRVPELAGLKSGLGALLSGDRALLEQHYRVSGQGQPQAWQLTL
QPKDAAVARQVHELRLYGRNDELRCIESVPARGDMQRTLLGAAAREATGI
IDASALTTLCHGSGA
X.species

NP_644395.1 lcl|XAC4096-XAC4096

1

215

S=925 I=88 E=3.29759e-105

fatty acyl CoA synthetase

X.species

YP_365915.1 lcl|XCV4184

1

215

S=908 I=87 E=3.07029e-103

putative secreted protein

X.species

NP_639346.1 lcl|XCC4007

1

215

S=844 I=81 E=1.95509e-95

fatty acyl CoA synthetase

X.species

lcl|XALc_0134

1

212

S=580 I=61 E=1.6848e-63

hypothetical secreted protein

pubmed

1

215

S=943 I=85 E=7.50111e-106

Putative uncharacterized protein

Pubmed 12057948

 

prodomImg

Iprscan [seg]

113

126

-

PD589609

43

190

S=209 I=37 E=6.71436e-18

PD661456

188

215

S=107 I=79 E=1.67503e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 2ZfdxlXi)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

1 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

2 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnDzT5_/XFF4834R_chr39630.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnDzT5_/XFF4834R_chr39630.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnDzT5_/XFF4834R_chr39630.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnDzT5_/XFF4834R_chr39630.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.