Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr39620XFF4834R_chr42890371_4565598_r1_XFF4834R-XFF4834R_chr39620XFF4834R_chr39620hypothetical xanthomonadin secreted protein

XFF4834R_chr42890371_4565598_r1_XFF4834R-XFF4834R_chr39620 XFF4834R_chr39620
XFF4834R_chr39610
XFF4834R_chr39610
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr39630
XFF4834R_chr39630
ID XFF4834R_chr42890371_4565598_r1_XFF4834R-XFF4834R_chr39620
AC XFF4834R_chr39620
LT XFF4834R_chr39620
OR XFF4834R_chr from 4565371 to 4565598 on strand -
DE hypothetical xanthomonadin secreted protein
IP
CL 10.2 Conserved hypothetical protein
EC
GO InterPro


Curated
PM
AN >Sequence Prediction: Signal peptide Signal peptide probability: 0.862
CC COG: [S] Function unknown;
CC MODEL: XFF4834R
CC STATUS: curated by jacques (20101118)
MW 7866.1 Da
SQ 75 aa
 
........10........20........30........40........50
| | | | |
MALELNANRRIGLALLWLALLAVAGLWLSETLKVTGDLRKFMPALRKNNA
SLQPDAARAAGGRSAAVAGHAHHGA
Show or not Domain decomposition
 
XFF4834R

XFF4834R_chr39610 lcl|XFF4834R_chr42870015_4565381_r2_XFF4834R-XFF4834R_chr39610

1

46

S=120 I=61 E=3.97343e-09

X.species

YP_365914.1 lcl|XCV4183

1

55

S=173 I=69 E=5.82485e-15

putative xanthomonadin exporter (fragment)

X.species

YP_365913.1 lcl|XCV4182

1

55

S=173 I=69 E=5.82485e-15

putative xanthomonadin exporter (fragment)

X.species

NP_644394.1 lcl|XAC4095-XAC4095

1

55

S=167 I=65 E=3.10666e-14

hypothetical protein

X.species

NP_644393.1 lcl|XAC4094-XAC4094

1

55

S=167 I=65 E=3.10666e-14

membrane protein

X.species

YP_365912.1 lcl|XCV4181

1

46

S=120 I=61 E=1.6357e-08

xanthomonadin exporter

X.species

NP_639345.1 lcl|XCC4006

1

55

S=112 I=56 E=1.39696e-07

membrane protein

X.species

NP_644392.1 lcl|actII-3-XAC4093

1

46

S=112 I=57 E=1.57832e-07

membrane protein

X.species

NP_639344.1 lcl|actII-3-XCC4005

1

46

S=109 I=57 E=3.582e-07

membrane protein

pubmed

1

46

S=120 I=61 E=8.53431e-07

Putative inner membrane protein

Pubmed 12057948

 

prodomImg

Iprscan [seg]

12

28

-

Iprscan [seg]

56

75

-

Iprscan [SignalP-NN(euk)]

1

29

-

Iprscan [tmhmm]

13

32

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one nA2rdl9j)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

1 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

4 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBmZiD_R/XFF4834R_chr39620.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBmZiD_R/XFF4834R_chr39620.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBmZiD_R/XFF4834R_chr39620.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBmZiD_R/XFF4834R_chr39620.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.