Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr39610XFF4834R_chr42870015_4565381_r2_XFF4834R-XFF4834R_chr39610XFF4834R_chr39610hypothetical xanthomonadin membrane transporter

XFF4834R_chr42870015_4565381_r2_XFF4834R-XFF4834R_chr39610 XFF4834R_chr39610
XFF4834R_chr39600
XFF4834R_chr39600
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr39620
XFF4834R_chr39620
ID XFF4834R_chr42870015_4565381_r2_XFF4834R-XFF4834R_chr39610
AC XFF4834R_chr39610
LT XFF4834R_chr39610
OR XFF4834R_chr from 4563015 to 4565381 on strand -
DE hypothetical xanthomonadin membrane transporter
IP
CL 7.3 Inner membrane GO:0005886
EC
GO InterPro


Curated
PM
AN orthologous to orf4 of the pig cluster: XOO4064 and XCC4005
CC COG: [RS] General function prediction only;Function unknown;
CC MODEL: XFF4834R
CC STATUS: curated by jacques (20101118)
MW 83431.1 Da
SQ 788 aa
 
........10........20........30........40........50
| | | | |
MALELNANRRIGLALLWLAVLAVAGFWLSETLKVTGDLRKFMPAPRTPAQ
KLLIEELGEGPGSRLLLMALSNSDPVTLAEQSQQLHQALSAQPALFELVG
NGGNAGLEAIPKRLLPYRYLLSDSFDKTPLDAPALEAALQARVQDLGSPA
AAMVEPLLPRDPTMEILHLADTLQPAVMPRTRNDVWFDRAGTSALLIVQT
RAAGFDPTGQQLAYDAVQAAFAKVSKGTTTQLTLTGPGAFAVEITARTQG
EAQWIGTLDTVGLVLLLLVAYRSWKIPVLGVLPLASAGLAGLGAVALLFD
GVHGITVAFGFTLIGVVQDYPIHLFSHQRPGLDPRENARHLWPTLATGVV
STCIAYVTFLFSGVDGLRQLAVFTIAGLATAAVTTRWLLPALIDPAPRDY
ADSRLLAVLWRGIARLPRPRISLAVMAVIGIAVIVFAPGQFWQNDLSKLT
PVPPKALAQDTHLRQELGAPDVRYVLALPAASDEAALQASEQLRPRLDAL
VRDGALLGYDMAARYLPSASTQRARQAALPDAAQARALTERAVATTPFRS
DAFAPFLQDLDAAKRAAPLLPKDLSGSPLATSVGGLLLGRGDRSTALVSL
TGLRDPAVLAAAVQGSGAQLLDLKDASESLVAAYRGRVLGALVLAALLLA
VTVAIALRSPRRIVRVLLPMALTTVLILAILRGAGVELNLFHLIALILAA
GLGLDYALFFDHAGDDHADQLRTLHALIVCSLMTLLVFALLAASSIPVLR
AIGSTVALGVLFNFILALLVSREPALERTANGEPHAGT
XFF4834R

XFF4834R_chr39620 lcl|XFF4834R_chr42890371_4565598_r1_XFF4834R-XFF4834R_chr39620

1

46

S=122 I=61 E=6.96481e-08

X.species

YP_365912.1 lcl|XCV4181

1

788

S=3038 I=79 E=0

xanthomonadin exporter

X.species

NP_644392.1 lcl|actII-3-XAC4093

1

788

S=3009 I=79 E=0

membrane protein

X.species

NP_639344.1 lcl|actII-3-XCC4005

1

783

S=2723 I=74 E=0

membrane protein

X.species

lcl|XALc_0135

30

786

S=2274 I=66 E=0

hypothetical xanthomonadin exporter protein

X.species

YP_365914.1 lcl|XCV4183

1

46

S=118 I=61 E=8.77676e-07

putative xanthomonadin exporter (fragment)

X.species

YP_365913.1 lcl|XCV4182

1

46

S=118 I=61 E=8.77676e-07

putative xanthomonadin exporter (fragment)

X.species

NP_644394.1 lcl|XAC4095-XAC4095

1

46

S=113 I=57 E=3.60369e-06

hypothetical protein

X.species

NP_644393.1 lcl|XAC4094-XAC4094

1

46

S=113 I=57 E=3.60369e-06

membrane protein

X.species

NP_639345.1 lcl|XCC4006

1

43

S=107 I=56 E=2.02524e-05

membrane protein

pubmed

1

788

S=3003 I=78 E=0

Putative inner membrane protein

Pubmed 12057948

 

prodomImg

pubmed

304

515

S=319 I=37 E=1.81729e-29

Lfe127p1

Pubmed 12808145

 

prodomImg

Iprscan [PF03176]

191

415

-

Iprscan [seg]

12

28

-

Iprscan [seg]

78

95

-

Iprscan [seg]

227

236

-

Iprscan [seg]

256

269

-

Iprscan [seg]

278

302

-

Iprscan [seg]

424

437

-

Iprscan [seg]

522

537

-

Iprscan [seg]

638

657

-

Iprscan [seg]

688

709

-

Iprscan [SignalP-NN(euk)]

1

29

-

Iprscan [tmhmm]

13

32

-

Iprscan [tmhmm]

254

271

-

Iprscan [tmhmm]

276

298

-

Iprscan [tmhmm]

303

325

-

Iprscan [tmhmm]

338

360

-

Iprscan [tmhmm]

370

389

-

Iprscan [tmhmm]

421

443

-

Iprscan [tmhmm]

638

657

-

Iprscan [tmhmm]

664

686

-

Iprscan [tmhmm]

690

709

-

Iprscan [tmhmm]

721

743

-

Iprscan [tmhmm]

748

770

-

PD326777

339

506

S=259 I=39 E=1.29757e-23

PD871487

506

637

S=253 I=50 E=6.39827e-23

PD589489

166

243

S=186 I=52 E=8.92966e-15

PD369049

1

64

S=184 I=61 E=1.24372e-14

PDA1H3S0

65

168

S=158 I=39 E=1.7737e-11

Iprscan [SSF82866]

207

398

-

Iprscan [SSF82866]

617

770

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one TaI9UBV2)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

2 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

25 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB5HGLw9/XFF4834R_chr39610.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB5HGLw9/XFF4834R_chr39610.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB5HGLw9/XFF4834R_chr39610.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB5HGLw9/XFF4834R_chr39610.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.