Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr39600XFF4834R_chr42860597_4563028_r3_XFF4834R-XFF4834R_chr39600XFF4834R_chr39600hypothetical xanthomonadin biosynthesis protein

XFF4834R_chr42860597_4563028_r3_XFF4834R-XFF4834R_chr39600 XFF4834R_chr39600
XFF4834R_chr39590
XFF4834R_chr39590
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr39610
XFF4834R_chr39610
ID XFF4834R_chr42860597_4563028_r3_XFF4834R-XFF4834R_chr39600
AC XFF4834R_chr39600
LT XFF4834R_chr39600
OR XFF4834R_chr from 4562597 to 4563028 on strand -
DE hypothetical xanthomonadin biosynthesis protein
IP
CL 10.2 Conserved hypothetical protein
EC
GO InterPro


Curated
PM
AN othologous to orf3 of the pig cluster: XOO4069 and XCC4004
CC COG: [I] Lipid transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by jacques (20100820)
MW 15747 Da
SQ 143 aa
 
........10........20........30........40........50
| | | | |
MQGRDAIAALIPHQGSMCLWEEVIEWDAQRIVLRSHAHRSDAHPLRSNGR
LRALHLCEYGAQAMAVHGGLLGRESGKPVRPGMLVALRSVEVHVMYLDTL
PDAIDCQAQVLMQGEDSQQYSFRLTHGEQLLAEGRATVMLGAA
X.species

NP_644391.1 lcl|XAC4092-XAC4092

1

142

S=724 I=98 E=3.56373e-81

phosphotransferase

X.species

YP_365911.1 lcl|XCV4180

1

143

S=675 I=91 E=3.16596e-75

xanthomonadin biosynthesis protein

X.species

NP_639343.1 lcl|XCC4004

1

143

S=631 I=85 E=6.01025e-70

phosphotransferase

X.species

lcl|XALc_0136

1

143

S=531 I=72 E=8.96409e-58

hypothetical xanthomonadin biosynthesis protein

pubmed

1

143

S=699 I=93 E=1.38664e-76

Putative uncharacterized protein

Pubmed 12057948

 

prodomImg

PD398202

17

142

S=200 I=40 E=7.97887e-17

Iprscan [SSF54637]

1

140

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one tN50zt1z)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

1 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

1 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBTYRcMl/XFF4834R_chr39600.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBTYRcMl/XFF4834R_chr39600.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBTYRcMl/XFF4834R_chr39600.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBTYRcMl/XFF4834R_chr39600.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.