Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr39180XFF4834R_chr42390943_4514929_f2_XFF4834R-XFF4834R_chr39180XFF4834R_chr39180putative TonB-like protein

XFF4834R_chr42390943_4514929_f2_XFF4834R-XFF4834R_chr39180 XFF4834R_chr39180
XFF4834R_chr39170
XFF4834R_chr39170
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr39190
XFF4834R_chr39190
ID XFF4834R_chr42390943_4514929_f2_XFF4834R-XFF4834R_chr39180
AC XFF4834R_chr39180
LT XFF4834R_chr39180
OR XFF4834R_chr from 4513919 to 4514929 on strand +
DE putative TonB-like protein
IP Gram-negative bacterial tonB protein
CL 4.2.C.1 TonB Family of Auxiliary Proteins for Energization of OMR-mediated Transport
EC
GO InterPro
Biological Process: protein transport (GO:0015031)
Biological Process: iron ion transport (GO:0006826)
Cellular Component: membrane (GO:0016020)
Cellular Component: outer membrane-bounded periplasmic space (GO:0030288)
Molecular Function: iron ion transmembrane transporter activity (GO:0005381)
Molecular Function: protein transporter activity (GO:0008565)

Curated
PM
AN start change
CC COG: [M] Cell wall/membrane/envelope biogenesis;
CC MODEL: XFF4834R
CC STATUS: curated by irobene (20100820)
MW 35601.7 Da
SQ 336 aa
 
........10........20........30........40........50
| | | | |
MLDLTQGRMARRIAPVILLVGLAACSKQEDKAATATPATGATPAATAPTP
ATAVSPQVQSMAAEQLRESATKALQDNRMYAPAGDNAVEYYLALREKQPQ
DATVNSALTDLLPYTLIAAEQGISREEFPEAQRLIALIEKVDPQAPALPR
LKSGLETGMKTAANRSEQDAEQAKKQVEDKAKQAAEQKRLAEQQSREAAA
AQQIAAQQEAARQQTAEAERQAAARRQAEAPAPTPAAPRPAPAAAAAAAP
AAQSLRPISTPAPRYPAEALRSGTSGEVLVELTVGTDGSITASRVLRANP
PRVFDREALNAVKRWRFEPVAAPVTTRRTLSFNPGD
XFF4834R

XFF4834R_chr18580 lcl|XFF4834R_chr19920044_2123721_r1_XFF4834R-XFF4834R_chr18580

255

319

S=129 I=45 E=3.89785e-09

XFF4834R

XFF4834R_chr00080 lcl|XFF4834R_chr00080925_0011593_f2_XFF4834R-XFF4834R_chr00080

263

318

S=114 I=36 E=2.56063e-07

XFF4834R

XFF4834R_chr12880 lcl|XFF4834R_chr_1467687_1468991_f3_XFF4834R-XFF4834R_chr12880

263

319

S=107 I=35 E=1.96965e-06

X.species

YP_365873.1 lcl|XCV4142

1

190

S=827 I=88 E=4.07568e-93

hypothetical protein

X.species

YP_365873.1 lcl|XCV4142

254

336

S=445 I=100 E=8.37419e-47

hypothetical protein

X.species

NP_644351.1 lcl|XAC4052-XAC4052

1

190

S=824 I=88 E=1.04506e-92

TonB-like protein

X.species

NP_644351.1 lcl|XAC4052-XAC4052

254

336

S=445 I=100 E=8.08717e-47

TonB-like protein

X.species

NP_639306.1 lcl|XCC3967

1

190

S=786 I=84 E=3.95391e-88

TonB-like protein

X.species

NP_639306.1 lcl|XCC3967

254

335

S=427 I=96 E=1.37419e-44

TonB-like protein

X.species

lcl|XALc_3003

55

182

S=436 I=68 E=1.11567e-45

hypothetical protein

X.species

lcl|XALc_3003

254

335

S=356 I=77 E=4.4292e-36

hypothetical protein

X.species

lcl|tonB3-XALc_1701

261

335

S=141 I=40 E=5.7288e-10

putative tonb_protein

X.species

YP_364661.1 lcl|tonB4-XCV2930

255

319

S=127 I=45 E=2.37083e-08

TonB-like protein

X.species

NP_643083.1 lcl|XAC2774-XAC2774

255

319

S=127 I=45 E=2.82248e-08

TonB-like protein

X.species

NP_637960.1 lcl|tonB-XCC2612

255

319

S=120 I=42 E=2.17107e-07

TonB like protein

X.species

lcl|XALc_0008

263

318

S=118 I=38 E=3.76031e-07

putative energy transducer tonb protein

X.species

NP_635403.1 lcl|tonB-XCC0008

263

318

S=116 I=36 E=5.19187e-07

TonB protein

X.species

YP_361739.1 lcl|tonB1-XCV0008

263

318

S=114 I=36 E=9.64197e-07

energy transducer TonB protein

X.species

NP_640364.1 lcl|tonB-XAC0008

263

318

S=114 I=36 E=9.64197e-07

TonB protein

X.species

NP_643669.1 lcl|XAC3362-XAC3362

263

319

S=114 I=37 E=1.08937e-06

TonB-like protein

X.species

YP_365210.1 lcl|blaR1-XCV3479

263

319

S=112 I=37 E=1.64113e-06

putative BlaR1 antirepressor (fragment)

pubmed

254

319

S=149 I=41 E=2.52554e-09

TonB-like protein

Pubmed 18324396

 

prodomImg

pubmed

257

319

S=145 I=40 E=7.57624e-09

TonB2

Pubmed 15557661

 

prodomImg

pubmed

257

318

S=139 I=39 E=4.04076e-08

TonB2 protein

Pubmed 15689115

 

prodomImg

pubmed

256

322

S=136 I=40 E=9.25083e-08

Protein tonB ; Cell inner membrane transport Repeat Signal-anchor Transmembrane

Pubmed 8384290

 

prodomImg

pubmed

257

319

S=133 I=37 E=2.09948e-07

TonB2

Pubmed 18629473

 

prodomImg

sp

256

322

S=136 I=40 E=6.2948e-08

Protein tonB ; Cell inner membrane transport Repeat Signal-anchor Transmembrane

 

prodomImg

sp

255

319

S=131 I=42 E=2.77133e-07

Protein tonB ; Cell inner membrane transport Repeat Transmembrane

 

prodomImg

sp

256

319

S=125 I=41 E=1.43992e-06

Protein tonB ; Bacteriocin transport Cell inner membrane Phage recognition Repeat Signal-anchor Transmembrane

 

prodomImg

sp

256

318

S=124 I=38 E=1.9881e-06

Protein tonB ; Bacteriocin transport Cell inner membrane Phage recognition Repeat Signal-anchor Transmembrane

 

prodomImg

sp

263

318

S=116 I=36 E=1.47684e-05

Protein tonB ; Cell inner membrane transport Repeat Signal-anchor Transmembrane

 

prodomImg

Iprscan [coil]

160

222

-

Iprscan IPR003538 [PR01374]

257

278

Gram-negative bacterial tonB protein

Iprscan IPR003538 [PR01374]

278

296

Gram-negative bacterial tonB protein

Iprscan IPR003538 [PR01374]

297

314

Gram-negative bacterial tonB protein

Iprscan IPR006260 [PF03544]

261

332

TonB, C-terminal

Iprscan IPR006260 [TIGR01352]

263

335

TonB, C-terminal

Iprscan [seg]

32

53

-

Iprscan [seg]

191

253

-

Iprscan [SignalP-NN(euk)]

1

25

-

PD689285

54

190

S=568 I=82 E=2.16422e-61

PDA1K9K4

254

294

S=187 I=90 E=3.16497e-15

PDA1Q8F0

295

336

S=163 I=74 E=2.65187e-12

PD691911

1

31

S=159 I=100 E=8.75594e-12

PD667654

258

334

S=110 I=30 E=6.5339e-06

PD492945

276

318

S=109 I=47 E=9.75779e-06

PDA2R1T7

261

320

S=108 I=33 E=1.37096e-05

Iprscan [SSF74653]

228

336

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 9dsFjqMI)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

13 hits
swiss-prot

Swiss-Prot ncbi-blastp

7 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

5 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

10 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBxrNdF5/XFF4834R_chr39180.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBxrNdF5/XFF4834R_chr39180.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBxrNdF5/XFF4834R_chr39180.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBxrNdF5/XFF4834R_chr39180.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.