Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr39000aroEXFF4834R_chr39000shikimate 5-dehydrogenase

aroE XFF4834R_chr39000
XFF4834R_chr38990
XFF4834R_chr38990
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr39010
XFF4834R_chr39010
ID aroE
AC XFF4834R_chr39000
LT XFF4834R_chr39000
OR XFF4834R_chr from 4490480 to 4491331 on strand -
DE shikimate 5-dehydrogenase
IP Quinate/shikimate 5-dehydrogenase; Shikimate dehydrogenase substrate binding, N-terminal; NAD(P)-binding domain
CL 1.5.1 Amino acids GO:0008652
EC
GO InterPro
Biological Process: oxidation reduction (GO:0055114)
Biological Process: metabolic process (GO:0008152)
Cellular Component: cytoplasm (GO:0005737)
Molecular Function: binding (GO:0005488)
Molecular Function: catalytic activity (GO:0003824)
Molecular Function: NADP or NADPH binding (GO:0050661)
Molecular Function: shikimate 5-dehydrogenase activity (GO:0004764)

Curated
PM
AN
CC COG: [E] Amino acid transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by koebnik (20101112)
MW 29723.1 Da
SQ 283 aa
 
........10........20........30........40........50
| | | | |
MPVSRYAVFGHPVAHSLSPAIHADFGKQAGIALDYTAIDAPQEDFSAALQ
RFADEGGKGANVTLPLKEAAYGLASSLSDRARLAGAVNTLVRNDGQWQGD
NTDGAGLVRDLTERQGLDLRGRRVLLLGAGGAARGVAPALLEAGITAMVV
VNRSPERADALCDALGEPARVTSRYIEDLRELGDFELIVNATAAGRDRDA
GAFALPLGLVNSLTAAVDLNYGDTAIAFLAWARAAQCRYAIDGLGMLVEQ
AAESFALWHGVRPDTDPVYAALRAREAVLISAD
Show or not Domain decomposition
 
pubmed

1

283

S=1095 I=77 E=4.33913e-124

Shikimate dehydrogenase ; Amino-acid biosynthesis Aromatic NADP Oxidoreductase

Pubmed 11133452

 

prodomImg

pubmed

6

273

S=411 I=38 E=2.95792e-41

Shikimate dehydrogenase EC=1.1.1.25 ; Amino-acid biosynthesis Aromatic NADP Oxidoreductase

Pubmed 3277621

 

prodomImg

pubmed

3

274

S=395 I=37 E=2.85178e-39

Shikimate dehydrogenase ; Amino-acid biosynthesis Aromatic NADP Oxidoreductase

Pubmed 9157250

 

prodomImg

pubmed

3

274

S=392 I=36 E=6.70182e-39

Shikimate dehydrogenase ; Amino-acid biosynthesis Aromatic NADP Oxidoreductase

Pubmed 9157250

 

prodomImg

pubmed

3

274

S=392 I=37 E=6.70182e-39

Shikimate dehydrogenase ; Amino-acid biosynthesis Aromatic NADP Oxidoreductase

Pubmed 9157250

 

prodomImg

pubmed

5

274

S=388 I=37 E=1.68874e-38

Shikimate dehydrogenase EC=1.1.1.25 ; Amino-acid biosynthesis Aromatic NADP Oxidoreductase

Pubmed 9157250

 

prodomImg

pubmed

3

274

S=388 I=37 E=1.82659e-38

Shikimate dehydrogenase EC=1.1.1.25 ; Amino-acid biosynthesis Aromatic NADP Oxidoreductase

Pubmed 9157250

 

prodomImg

pubmed

3

274

S=388 I=36 E=2.06373e-38

Shikimate dehydrogenase EC=1.1.1.25 ; Amino-acid biosynthesis Aromatic NADP Oxidoreductase

Pubmed 9157250

 

prodomImg

pubmed

3

268

S=384 I=37 E=5.15508e-38

Shikimate dehydrogenase ; Amino-acid biosynthesis Aromatic NADP Oxidoreductase

Pubmed 12517848

 

prodomImg

pubmed

3

273

S=384 I=36 E=5.97869e-38

Shikimate dehydrogenase EC=1.1.1.25 ; Amino-acid biosynthesis Aromatic NADP Oxidoreductase

Pubmed 9157250

 

prodomImg

sp

1

283

S=1175 I=84 E=5.69404e-134

Shikimate dehydrogenase EC=1.1.1.25 ; Amino-acid biosynthesis Aromatic NADP Oxidoreductase

 

prodomImg

sp

1

283

S=1173 I=83 E=9.69164e-134

Shikimate dehydrogenase EC=1.1.1.25 ; Amino-acid biosynthesis Aromatic NADP Oxidoreductase

 

prodomImg

sp

1

283

S=1100 I=78 E=6.49741e-125

Shikimate dehydrogenase EC=1.1.1.25 ; Amino-acid biosynthesis Aromatic NADP Oxidoreductase

 

prodomImg

sp

1

283

S=1094 I=77 E=3.81418e-124

Shikimate dehydrogenase EC=1.1.1.25 ; Amino-acid biosynthesis Aromatic NADP Oxidoreductase

 

prodomImg

sp

1

283

S=1094 I=77 E=3.81418e-124

Shikimate dehydrogenase EC=1.1.1.25 ; Amino-acid biosynthesis Aromatic NADP Oxidoreductase

 

prodomImg

Iprscan [G3DSA:3.40.192.10]

6

100

-

Iprscan IPR016040 [G3DSA:3.40.50.720]

101

279

NAD(P)-binding domain

Iprscan [PTHR21089]

135

281

-

Iprscan IPR013708 [PF08501]

8

90

Shikimate dehydrogenase substrate binding, N-terminal

Iprscan IPR006151 [PF01488]

114

197

Quinate/shikimate 5-dehydrogenase/glutamyl-tRNA reductase

Iprscan IPR011342 [TIGR00507]

4

277

Quinate/shikimate 5-dehydrogenase

Iprscan [seg]

114

141

-

Iprscan [seg]

191

204

-

PD120824

6

102

S=175 I=44 E=9.82159e-14

PDA1V1A0

181

227

S=147 I=70 E=2.30235e-10

PD170736

212

272

S=122 I=43 E=2.66351e-07

Iprscan IPR016040 [SSF51735]

103

277

NAD(P)-binding domain

Iprscan [SSF53223]

3

102

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one UGymaCqW)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

129 hits
swiss-prot

Swiss-Prot ncbi-blastp

453 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

10 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBB_QBvb/XFF4834R_chr39000.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBB_QBvb/XFF4834R_chr39000.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBB_QBvb/XFF4834R_chr39000.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBB_QBvb/XFF4834R_chr39000.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.