Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr38970dinGXFF4834R_chr38970ATP-dependent DNA helicase

dinG XFF4834R_chr38970
XFF4834R_chr_4146
XFF4834R_chr_4146
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr38980
XFF4834R_chr38980
ID dinG
AC XFF4834R_chr38970
LT XFF4834R_chr38970
OR XFF4834R_chr from 4487480 to 4489666 on strand -
DE ATP-dependent DNA helicase
IP DNA/RNA helicase, C-terminal; Helicase, ATP-dependent, c2 type; Helicase, superfamily 1/2, ATP-binding domain, DinG/Rad3-type
CL 2.1 DNA related GO:0006259
EC
GO InterPro
Molecular Function: nucleic acid binding (GO:0003676)
Molecular Function: helicase activity (GO:0004386)
Molecular Function: ATP-dependent helicase activity (GO:0008026)
Molecular Function: ATP binding (GO:0005524)
in phosphorus-containing anhydrides (GO:0016818)
nucleotide and nucleic acid metabolic process (GO:0006139)

Curated
PM
AN
CC COG: [KL] Transcription;Replication, recombination and repair;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120316)
MW 78911.3 Da
SQ 728 aa
 
........10........20........30........40........50
| | | | |
MRRAGRSHCAGPCENSAMSEVAPPAAPSAPVPTQRRLTDPIKASIRDAYA
KLQANTPGFATRRAQSQMIGLVSRALATSGGIGIAEAPTGVGKSLGYLTA
GVPIALATKKKLVISTGTVALQSQLVERDIPAFLKATGLDATVALAKGRT
RYLCTRNAAELEGDTSQNAMFEDEQALYDRPLSPVDADLAKRLAKAYAAR
TWNGDLDDAPEQISVPLRMRITTPASGCAGRRCSYAAQCPVLKARTDVRE
AQIVVTNHALLLSSLSLGDAENGQPLIAPPADMLLVLDEGHHIAGVAIDQ
GAANLPLDDMARRTGRMQILIAAAYRAVDKDKLGNLLPNEAIEVAARVSK
LLKAFHAEVERVWKPEPGERDPLWRAANGKLPPQWGPAIEELGEETRALF
NWVHAAHSAIAKGKQDDSARERLQRGLGLALEMAEQQHNLWSGWRREDKE
GQPPMARWITLSRDGDLICHCSPVSAAQVLRTMIWSEVDSVVMTSATLTG
GGDFQSFAIDNGLPDHAEMASLASPFDLPNQAELIVPNFPVTPDDREGHP
KEVAKYLVRELDWNAKGSIVLFTSRWKMEKVADLMPLAQRNRVLVQGEGN
KSQLITEHLRRIGAGEGSVLFGLNSFGEGLDLPGEACTTVVITQVPFAVP
TDPQTSTLSEWLESRGHNAFNLIAIPHALRTLTQFAGRLIRSSSDHGRVI
ILDSRLLTRRYGKRIIDALPPFKRVIGR
XFF4834R

XFF4834R_chr15250 lcl|XFF4834R_chr16360600_1753624_f2_XFF4834R-XFF4834R_chr15250

59

725

S=426 I=29 E=9.73968e-45

conserved protein with nucleoside triphosphate hydrolase domain

X.species

NP_644330.1 lcl|dinG-XAC4031

33

728

S=3521 I=96 E=0

ATP-dependent DNA helicase DinG

X.species

YP_365854.1 lcl|dinG-XCV4123

33

728

S=3505 I=96 E=0

ATP-dependent DNA helicase DinG

X.species

NP_639289.1 lcl|dinG-XCC3950

33

728

S=3402 I=92 E=0

ATP-dependent DNA helicase DinG

X.species

lcl|dinG-XALc_2992

35

727

S=2889 I=78 E=0

probable atp-dependent helicase protein

X.species

NP_643416.1 lcl|yoaA-XAC3107

59

725

S=429 I=29 E=1.65948e-44

ATP-dependent helicase

X.species

lcl|DinG-XALc_2247

458

724

S=319 I=34 E=3.72554e-31

putative dna helicase protein

X.species

lcl|DinG-XALc_2247

58

312

S=190 I=30 E=1.61978e-15

putative dna helicase protein

X.species

YP_364970.1 lcl|yoaA-XCV3239

458

725

S=305 I=34 E=1.58266e-29

ATP-dependent helicase

X.species

YP_364970.1 lcl|yoaA-XCV3239

59

299

S=190 I=30 E=1.33706e-15

ATP-dependent helicase

X.species

NP_638278.1 lcl|yoaA-XCC2930

458

725

S=304 I=34 E=2.0558e-29

ATP-dependent helicase

pubmed

2

727

S=3516 I=92 E=0

ATP-dependent helicase Putative damage-inducible protein G

Pubmed 11133452

 

prodomImg

pubmed

37

726

S=903 I=35 E=2.75085e-100

Putative ATP-dependent helicase

Pubmed 10722573

 

prodomImg

pubmed

37

726

S=856 I=33 E=1.30448e-94

Probable ATP-dependent helicase dinG homolog EC=3.6.1.- ; ATP-binding DNA damage recombination repair DNA-binding Hydrolase Nucleotide-binding

Pubmed 8396546

 

prodomImg

pubmed

37

722

S=767 I=32 E=7.20697e-84

Probable ATP-dependent helicase dinG EC=3.6.1.- ; ATP-binding DNA damage recombination repair DNA-binding Hydrolase Nucleotide-binding

Pubmed 8037924,1629168

 

prodomImg

pubmed

456

720

S=306 I=32 E=5.4351e-28

Probable ATP-dependent helicase dinG homolog EC=3.6.1.- ; ATP-binding DNA damage recombination repair DNA-binding Hydrolase Nucleotide-binding

Pubmed 8760912

 

prodomImg

pubmed

57

177

S=169 I=33 E=2.40261e-11

Probable ATP-dependent helicase dinG homolog EC=3.6.1.- ; ATP-binding DNA damage recombination repair DNA-binding Hydrolase Nucleotide-binding

Pubmed 8760912

 

prodomImg

pubmed

593

722

S=233 I=39 E=3.39827e-19

Putative ATP-dependent helicase

Pubmed 11832503,15522084

 

prodomImg

pubmed

463

720

S=217 I=27 E=3.19174e-17

ATP-dependent helicase DinG

Pubmed 16820506

 

prodomImg

pubmed

52

293

S=212 I=29 E=1.28786e-16

ATP-dependent helicase DinG

Pubmed 16820506

 

prodomImg

pubmed

449

727

S=172 I=20 E=9.87324e-12

Probable ATP-dependent helicase dinG homolog EC=3.6.1.- ; ATP-binding DNA damage recombination repair DNA-binding Hydrolase Nucleotide-binding

Pubmed 11717293

 

prodomImg

Iprscan IPR006555 [SM00491]

577

708

Helicase, ATP-dependent, c2 type

Iprscan IPR014013 [PS51193]

51

337

Helicase, superfamily 1/2, ATP-binding domain, DinG/Rad3-type

Iprscan IPR001650 [PS51194]

557

727

DNA/RNA helicase, C-terminal

Iprscan [seg]

16

32

-

Iprscan [seg]

186

200

-

Iprscan [seg]

260

267

-

PD690973

336

370

S=173 I=97 E=2.94076e-13

PDA1T1X9

538

566

S=163 I=100 E=4.78785e-12

PD403018

453

545

S=148 I=40 E=3.0641e-10

PD864690

33

61

S=144 I=97 E=7.7886e-10

PDA2O2C4

211

238

S=139 I=96 E=3.31146e-09

PDA0A1L9

657

722

S=137 I=41 E=6.53682e-09

PD329182

114

176

S=125 I=43 E=1.6602e-07

PD686483

371

466

S=124 I=36 E=2.61251e-07

PDA1F7H0

668

720

S=110 I=45 E=1.14922e-05

PD004168

614

653

S=109 I=50 E=1.51904e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one v4nNyaMS)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

16 hits
swiss-prot

Swiss-Prot ncbi-blastp

45 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

8 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBtQAZNV/XFF4834R_chr38970.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBtQAZNV/XFF4834R_chr38970.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBtQAZNV/XFF4834R_chr38970.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBtQAZNV/XFF4834R_chr38970.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.